-
Notifications
You must be signed in to change notification settings - Fork 199
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Covalent ligand example + bugfix (#244)
* Update README with covalent ligand example; rename some files * Fix dtypes * Improve logging * Typo fix + assert check * Correct restraint * Update README * README updates * Rename folder * Update README * Update README
- Loading branch information
Showing
13 changed files
with
57 additions
and
10 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
File renamed without changes.
File renamed without changes.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,4 @@ | ||
>protein|8cyo-protein | ||
MKKGHHHHHHGAISLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNTLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF | ||
>ligand|8cyo-ligand | ||
c1cc(c(cc1OCC(=O)NCCS)Cl)Cl |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,2 @@ | ||
chainA,res_idxA,chainB,res_idxB,connection_type,confidence,min_distance_angstrom,max_distance_angstrom,comment,restraint_id | ||
A,C217@SG,B,@S1,covalent,1.0,0.0,0.0,protein-ligand,bond1 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Loading
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
File renamed without changes
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,27 @@ | ||
import logging | ||
import shutil | ||
from pathlib import Path | ||
|
||
from chai_lab.chai1 import run_inference | ||
|
||
logging.basicConfig(level=logging.INFO) | ||
|
||
# Inference expects an empty directory; enforce this | ||
output_dir = Path("/workspaces/chai-lab/tmp/outputs") | ||
if output_dir.exists(): | ||
logging.warning(f"Removing old output directory: {output_dir}") | ||
shutil.rmtree(output_dir) | ||
output_dir.mkdir(exist_ok=True, parents=True) | ||
|
||
candidates = run_inference( | ||
fasta_file=Path(__file__).with_name("8cyo.fasta"), | ||
output_dir=output_dir, | ||
constraint_path=Path(__file__).with_name("8cyo.restraints"), | ||
num_trunk_recycles=3, | ||
num_diffn_timesteps=200, | ||
seed=42, | ||
device="cuda:0", | ||
use_esm_embeddings=True, | ||
) | ||
|
||
cif_paths = candidates.cif_paths |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters