diff --git a/pr-preview/pr-344/_sources/trajectories/pseudotemporal.ipynb b/pr-preview/pr-344/_sources/trajectories/pseudotemporal.ipynb index 59d7fcef..2e602e23 100644 --- a/pr-preview/pr-344/_sources/trajectories/pseudotemporal.ipynb +++ b/pr-preview/pr-344/_sources/trajectories/pseudotemporal.ipynb @@ -45,7 +45,7 @@ "`````\n", "``````\n", "\n", - "````{dropdown} Access to data and notebook\n", + "````{dropdown} Access to data and notebook\n", "```{include} ../_static/default_text_lamindb_setup.md\n", "```\n", "````" diff --git a/pr-preview/pr-344/_static/default_text_lamindb_setup.md b/pr-preview/pr-344/_static/default_text_lamindb_setup.md index ce9498d5..0edd24e3 100644 --- a/pr-preview/pr-344/_static/default_text_lamindb_setup.md +++ b/pr-preview/pr-344/_static/default_text_lamindb_setup.md @@ -41,11 +41,12 @@ We acknowledge free hosting from [Lamin Labs](https://lamin.ai/). ```python import lamindb as ln - af = ln.Artifact.get(key="key_of_dataset", is_latest=True) + af = ln.Artifact.get(key="key_of_dataset", is_latest=True) # or ln.Artifact("SOMEID").get() obj = af.load() ``` The object is now accessible in memory and is ready for analysis. + Adapt the `ln.Artifact("SOMEID").get()` suffix to get older versions like `ln.Artifact("SOMEID0001").get()` to get the second uploaded version. 6. **Accessing notebooks (Transforms)** @@ -57,7 +58,8 @@ We acknowledge free hosting from [Lamin Labs](https://lamin.ai/). ``` which will download the notebook to the current working directory. + Analogously to `Artifacts`, you can adapt the suffix ID to get older versions. -7. \*\*On `ln.track()` and `ln.finish()` +7. **On `ln.track()` and `ln.finish()`** - These functions are currently only available for users with write access and may error. Please comment them out for now. diff --git a/pr-preview/pr-344/searchindex.js b/pr-preview/pr-344/searchindex.js index a370c8ef..aeafdbb5 100644 --- a/pr-preview/pr-344/searchindex.js +++ b/pr-preview/pr-344/searchindex.js @@ -1 +1 @@ -Search.setIndex({"alltitles": {"A Note on UMI Errors": [[23, null]], "A brief history of sequencing": [[24, "a-brief-history-of-sequencing"]], "A more mathematical description of deconvolution": [[36, "a-more-mathematical-description-of-deconvolution"]], "A note on alignment orientation": [[23, null]], "A note on preceding steps": [[23, null]], "A note on scalability": [[7, null]], "A note on sequencing length": [[24, null]], "A note on the redundancy between gene sets and the performance of preranked and fry gene set tests": [[15, "a-note-on-the-redundancy-between-gene-sets-and-the-performance-of-preranked-and-fry-gene-set-tests"]], "A real-world example": [[23, "a-real-world-example"]], "ADT": [[12, "adt"]], "AIR analysis on RNA clusters": [[3, "air-analysis-on-rna-clusters"]], "AIR repertoire analysis": [[2, "air-repertoire-analysis"]], "API overview": [[19, "api-overview"]], "ATAC": [[12, "atac"]], "Accessing Python from R": [[21, "accessing-python-from-r"]], "Accessing R from Python": [[21, "accessing-r-from-python"]], "Acknowledgements": [[0, null]], "Adding aligned metadata": [[19, "adding-aligned-metadata"]], "Advanced integration": [[27, null]], "Advanced: Multimodal data analysis with muon": [[19, "advanced-multimodal-data-analysis-with-muon"]], "Advanced: Using MuData to store multimodal data": [[19, "advanced-using-mudata-to-store-multimodal-data"]], "Alignment and mapping": [[23, "alignment-and-mapping"]], "Alternative formats": [[30, "alternative-formats"]], "Analysing single-pooled CRISPR screens": [[16, "analysing-single-pooled-crispr-screens"]], "Analysis frameworks and tools": [[19, null]], "Analytic Pearson residuals": [[33, "analytic-pearson-residuals"]], "Annotation": [[5, null], [43, null]], "Annotation by mapping to a reference": [[5, "annotation-by-mapping-to-a-reference"]], "Approaches": [[17, "approaches"], [25, "approaches"]], "Assigning AIR State": [[2, "assigning-air-state"]], "Assumptions & Limitations": [[25, "assumptions-limitations"]], "Atlas building and reference mapping": [[29, "atlas-building-and-reference-mapping"]], "Augur model": [[16, null]], "Authors": [[5, "authors"], [6, "authors"], [7, "authors"], [8, "authors"], [9, "authors"], [11, "authors"], [13, "authors"], [14, "authors"], [15, "authors"], [16, "authors"], [17, "authors"], [19, "authors"], [21, "authors"], [23, "authors"], [24, "authors"], [26, "authors"], [27, "authors"], [28, "authors"], [31, "authors"], [32, "authors"], [33, "authors"], [34, "authors"], [36, "authors"], [37, "authors"], [38, "authors"], [39, "authors"], [40, "authors"], [41, "authors"], [43, "authors"], [44, "authors"], [45, "authors"], [46, "authors"], [47, "authors"], [48, "authors"], [49, "authors"], [50, "authors"]], "Authors:": [[25, "authors"]], "Automated annotation": [[5, "automated-annotation"], [43, "automated-annotation"]], "BCR Data Analysis with Dandelion": [[1, "bcr-data-analysis-with-dandelion"]], "BCR specificity analysis": [[4, "bcr-specificity-analysis"]], "Background": [[17, "background"]], "Batch correction": [[44, null]], "Batch removal complexity": [[7, "batch-removal-complexity"]], "Batch-aware feature selection": [[7, "batch-aware-feature-selection"]], "Benchmarking": [[29, "benchmarking"]], "Benchmarking your own integration": [[7, "benchmarking-your-own-integration"]], "Benisse": [[3, "benisse"]], "Bioconductor": [[21, "bioconductor"]], "Bioconductor OSCA and OSTA books": [[22, "bioconductor-osca-and-osta-books"]], "Brief discussion": [[23, "brief-discussion"]], "Building the index": [[23, "building-the-index"]], "Building the model": [[7, "building-the-model"]], "Building the reference": [[27, "building-the-reference"]], "Bulk deconvolution": [[17, null]], "CITE-seq data": [[28, "cite-seq-data"]], "Calculate a batch-corrected UMAP": [[7, "calculate-a-batch-corrected-umap"]], "Calculate and visualize tumors\u2019 statistics": [[49, "calculate-and-visualize-tumors-statistics"]], "Calculating QC metrics": [[11, "calculating-qc-metrics"]], "Calculating local perturbation signatures": [[16, "calculating-local-perturbation-signatures"]], "Case Study": [[25, "case-study"]], "Case study: Pathway enrichment analysis and activity level scoring in human PBMC single cells": [[15, "case-study-pathway-enrichment-analysis-and-activity-level-scoring-in-human-pbmc-single-cells"]], "Cassiopeia for lineage tracing analysis": [[49, "cassiopeia-for-lineage-tracing-analysis"]], "Cell barcode correction": [[23, "cell-barcode-correction"]], "Cell isolation": [[2, "cell-isolation"]], "Cell-Aligned Data": [[2, "cell-aligned-data"]], "Cell-cell communication": [[25, null]], "Cell-level pathway activity scoring using AUCell": [[15, "cell-level-pathway-activity-scoring-using-aucell"]], "Cell-type specific expression of every gene in the spatial data": [[36, "cell-type-specific-expression-of-every-gene-in-the-spatial-data"]], "Cell2Location cell type mapping": [[36, "cell2location-cell-type-mapping"]], "Cell2Location in practice": [[36, "cell2location-in-practice"]], "Cell2location": [[36, "cell2location"]], "Centered Log-Ratio normalization": [[47, "centered-log-ratio-normalization"]], "Choosing an integration method": [[7, "choosing-an-integration-method"]], "Citation": [[30, "citation"]], "Classifiers based on a wider set of genes": [[5, "classifiers-based-on-a-wider-set-of-genes"]], "Clonal expansion": [[1, "clonal-expansion"]], "Clonal expansion: diversity and abundance": [[1, "clonal-expansion-diversity-and-abundance"]], "Clonotype abundance": [[1, "clonotype-abundance"]], "Clonotype analysis": [[1, null]], "Clonotype definition": [[1, "clonotype-definition"], [1, "id13"]], "Cluster-level gene set enrichment analysis with decoupler": [[15, "cluster-level-gene-set-enrichment-analysis-with-decoupler"]], "Clustering": [[6, null]], "Clustering human bone marrow cells": [[6, "clustering-human-bone-marrow-cells"]], "Co-occurrence across spatial dimensions": [[40, "co-occurrence-across-spatial-dimensions"]], "CoNGA": [[3, "conga"]], "Collecting cellranger outputs into MuData object": [[48, "collecting-cellranger-outputs-into-mudata-object"]], "Combining NicheNet output with ligand-receptor inference": [[25, "combining-nichenet-output-with-ligand-receptor-inference"]], "Common gene set between reference and spatial dataset": [[38, "common-gene-set-between-reference-and-spatial-dataset"]], "Common observations": [[19, "common-observations"]], "Comparisons of data integration methods": [[7, "comparisons-of-data-integration-methods"]], "Compositional analysis": [[13, null]], "Computational tools to interpret time-course lineage tracing data": [[49, "computational-tools-to-interpret-time-course-lineage-tracing-data"]], "Computing the map from single-cells to spatial voxels": [[38, "computing-the-map-from-single-cells-to-spatial-voxels"]], "Conclusions": [[49, "conclusions"]], "Configure data": [[27, "configure-data"]], "Constructing a map between technologies": [[38, "constructing-a-map-between-technologies"]], "Contact us": [[30, "contact-us"]], "Contributing": [[30, "contributing"]], "Contributions": [[25, "contributions"]], "Contributors": [[5, "contributors"], [6, "contributors"], [7, "contributors"], [8, "contributors"], [9, "contributors"], [11, "contributors"], [13, "contributors"], [14, "contributors"], [15, "contributors"], [16, "contributors"], [17, "contributors"], [19, "contributors"], [21, "contributors"], [23, "contributors"], [24, "contributors"], [26, "contributors"], [27, "contributors"], [28, "contributors"], [31, "contributors"], [32, "contributors"], [33, "contributors"], [34, "contributors"], [36, "contributors"], [37, "contributors"], [38, "contributors"], [39, "contributors"], [40, "contributors"], [41, "contributors"], [43, "contributors"], [44, "contributors"], [45, "contributors"], [46, "contributors"], [47, "contributors"], [48, "contributors"], [49, "contributors"], [50, "contributors"]], "Conversion of muon objects to Seurat objects to use in downstream analysis": [[10, null]], "Conversion to DataFrames": [[19, "conversion-to-dataframes"]], "Convert Seurat assay to chromatin assay": [[10, "convert-seurat-assay-to-chromatin-assay"]], "Correction of ambient RNA": [[34, "correction-of-ambient-rna"]], "Count cells in neighbourhoods": [[13, "count-cells-in-neighbourhoods"]], "Count data representation": [[23, "count-data-representation"]], "Count distribution-based doublet scoring": [[11, "count-distribution-based-doublet-scoring"]], "Count matrix quality control": [[23, "count-matrix-quality-control"]], "Coverage-based doublet scoring": [[11, "coverage-based-doublet-scoring"]], "Create pseudo-bulk samples and explore the data": [[15, "create-pseudo-bulk-samples-and-explore-the-data"]], "Current best practices in single-cell RNA-seq analysis: a tutorial": [[22, "current-best-practices-in-single-cell-rna-seq-analysis-a-tutorial"]], "Curse of dimensionality": [[31, null]], "DSB normalization": [[47, "dsb-normalization"]], "Dandelion interoperability": [[1, "dandelion-interoperability"]], "Data Preparation": [[3, "data-preparation"], [3, "id7"]], "Data Preprocessing": [[3, "data-preprocessing"]], "Data characteristics - feature definition and sparsity": [[9, "data-characteristics-feature-definition-and-sparsity"]], "Data exploration": [[16, "data-exploration"]], "Data infrastructure": [[20, null]], "Data integration": [[7, null]], "Data loading": [[13, "data-loading"], [50, "data-loading"], [51, "data-loading"]], "Data normalization": [[15, "data-normalization"]], "Data preparation": [[7, "data-preparation"]], "Data preprocessing": [[17, "data-preprocessing"], [51, "data-preprocessing"]], "Database Preparation": [[4, "database-preparation"]], "Database Queries": [[4, "database-queries"], [4, "id13"]], "Database query via distance metrics": [[4, "database-query-via-distance-metrics"]], "Dataset": [[2, "dataset"], [7, "dataset"], [11, "dataset"]], "Dataset description": [[26, "dataset-description"]], "Deconvolving bulk COVID-19 whole blood samples": [[17, "deconvolving-bulk-covid-19-whole-blood-samples"]], "Deconvolving using MuSiC": [[17, "deconvolving-using-music"]], "Define neighbourhoods": [[13, "define-neighbourhoods"]], "Determining the most important genes for the prioritization": [[16, "determining-the-most-important-genes-for-the-prioritization"]], "Differential gene expression analysis": [[14, null]], "Differential prioritization": [[16, "differential-prioritization"]], "Dimensionality Reduction": [[31, null], [45, null]], "Discrete tissue regions": [[36, "discrete-tissue-regions"]], "Disk-based interoperability": [[21, "disk-based-interoperability"]], "Distance Measurements": [[4, "distance-measurements"]], "Distances": [[4, "distances"]], "Doublet Detection": [[34, "doublet-detection"]], "Doublet detection": [[11, "doublet-detection"], [23, "doublet-detection"], [46, null]], "Doublets detected with cell type markers": [[46, "doublets-detected-with-cell-type-markers"]], "Down-stream tasks and outlook": [[50, "down-stream-tasks-and-outlook"]], "Downloading the data": [[49, "downloading-the-data"]], "Downstream analysis": [[36, "downstream-analysis"]], "Early stopping": [[7, null]], "Efficient data access": [[19, "efficient-data-access"]], "Empty droplet detection": [[23, "empty-droplet-detection"]], "End-to-end pipelines": [[29, "end-to-end-pipelines"]], "Environment setup": [[5, "environment-setup"], [10, "environment-setup"], [14, "environment-setup"], [17, "environment-setup"], [25, "environment-setup"], [26, "environment-setup"], [27, "environment-setup"], [28, "environment-setup"], [44, "environment-setup"], [45, "environment-setup"], [46, "environment-setup"], [47, "environment-setup"], [50, "environment-setup"], [51, "environment-setup"]], "Environment setup and data": [[34, "environment-setup-and-data"], [37, "environment-setup-and-data"], [40, "environment-setup-and-data"], [41, "environment-setup-and-data"], [48, "environment-setup-and-data"]], "Environment setup.": [[49, "environment-setup"]], "Epitope Prediction": [[4, "epitope-prediction"]], "Evaluating the predicted IFN-\u03b2 response": [[16, "evaluating-the-predicted-ifn-response"]], "Examine the data": [[49, "examine-the-data"]], "Executing CoNGA": [[3, "executing-conga"]], "Experimental assay": [[9, "experimental-assay"]], "Extracting the embedding": [[7, "extracting-the-embedding"]], "Feature selection": [[32, null]], "FigR": [[8, "figr"]], "Filtering": [[2, "filtering"]], "Filtering cells": [[11, "filtering-cells"]], "Filtering features": [[11, "filtering-features"]], "Filtering low quality cells": [[34, "filtering-low-quality-cells"]], "Filtering out low-quality tumors": [[49, "filtering-out-low-quality-tumors"]], "Filtering out the gene sets with low number of genes": [[15, "filtering-out-the-gene-sets-with-low-number-of-genes"]], "First-generation sequencing": [[24, "first-generation-sequencing"]], "Fitting the reference model": [[36, "fitting-the-reference-model"]], "Fluidigm C1": [[24, "fluidigm-c1"]], "Formation of adaptive immune receptors by V(D)J recombination": [[2, "formation-of-adaptive-immune-receptors-by-v-d-j-recombination"]], "From cluster differentially expressed genes to cluster annotation": [[5, "from-cluster-differentially-expressed-genes-to-cluster-annotation"]], "From markers to cluster annotation": [[5, "from-markers-to-cluster-annotation"]], "Further Models in Reference Based Deconvolution": [[36, "further-models-in-reference-based-deconvolution"]], "GEX analysis on AIR clusters": [[3, "gex-analysis-on-air-clusters"]], "Gamma-Poisson distribution": [[33, null]], "Gathering TF regulons from public data": [[26, "gathering-tf-regulons-from-public-data"]], "Gene regulatory network inference using RNA and ATAC features": [[8, "gene-regulatory-network-inference-using-rna-and-atac-features"]], "Gene regulatory networks": [[26, null]], "Gene regulatory networks using chromatin accessibility": [[8, null]], "Gene segment usage": [[1, "gene-segment-usage"]], "Gene segment usage and spectratype": [[1, "gene-segment-usage-and-spectratype"]], "Gene set enrichment and pathway analysis": [[15, null]], "Gene set enrichment for complex experimental designs using limma-fry and pseudo-bulks": [[15, "gene-set-enrichment-for-complex-experimental-designs-using-limma-fry-and-pseudo-bulks"]], "Gene set test vs. pathway activity inference": [[15, "gene-set-test-vs-pathway-activity-inference"]], "Gene set tests and pathway analysis": [[15, "gene-set-tests-and-pathway-analysis"]], "Gene usage": [[1, "gene-usage"]], "General remarks": [[5, "general-remarks"]], "General settings": [[51, "general-settings"]], "Generating a Ligand-Receptor consensus with LIANA": [[25, "generating-a-ligand-receptor-consensus-with-liana"]], "Generation of GRNs using RNA data": [[26, "generation-of-grns-using-rna-data"]], "Glossary": [[18, null]], "Graph construction": [[27, "graph-construction"]], "Graph-based integration": [[7, "graph-based-integration"]], "H5AD": [[21, "h5ad"]], "HDF5-based formats": [[21, "hdf5-based-formats"]], "Harmony": [[44, "harmony"]], "How many genes to use?": [[7, null]], "Hyperparameters of SpaGCN": [[37, "hyperparameters-of-spagcn"]], "IRs of the adaptive immune system": [[2, "irs-of-the-adaptive-immune-system"]], "Identical matches": [[4, "identical-matches"]], "Identifying cells with no detectable perturbation": [[16, "identifying-cells-with-no-detectable-perturbation"]], "Identifying interactions between spatial communities": [[40, "identifying-interactions-between-spatial-communities"]], "Identifying the cell types most affected by perturbations": [[16, "conditions-perturbation-modeling-key-takeaway-1"]], "Immune Receptor Profiling": [[2, null]], "Immune receptor sequencing": [[2, "immune-receptor-sequencing"]], "Imputation": [[38, null]], "Imputing genes and mapping cell-types to space": [[38, "imputing-genes-and-mapping-cell-types-to-space"]], "In-memory interoperability": [[21, "in-memory-interoperability"]], "Inferring expansion events": [[49, "inferring-expansion-events"]], "Inferring pseudotime for adult human bone marrow": [[50, "inferring-pseudotime-for-adult-human-bone-marrow"]], "Inferring tree plasticity": [[49, "inferring-tree-plasticity"]], "Initializing a MuData object": [[19, "initializing-a-mudata-object"]], "Initializing an AnnData object": [[19, "initializing-an-anndata-object"]], "Inspecting quality control metrics": [[31, "inspecting-quality-control-metrics"]], "Install and load FigR package": [[8, "install-and-load-figr-package"]], "Installation": [[19, "installation"], [19, "id12"], [19, "id18"], [19, "id20"]], "Integrate gene expression and histology into a Graph": [[37, "integrate-gene-expression-and-histology-into-a-graph"]], "Integrating AIR and transcriptomics": [[3, null]], "Integrating BCR and GEX": [[3, "integrating-bcr-and-gex"]], "Integrating TCR and GEX": [[3, "integrating-tcr-and-gex"]], "Integrating UMI and full-length data": [[7, null]], "Integration with partially overlapping data and query-to-reference mapping with totalVI": [[27, "integration-with-partially-overlapping-data-and-query-to-reference-mapping-with-totalvi"]], "Interoperability": [[21, null]], "Interoperability between R ecosystems": [[21, "interoperability-between-r-ecosystems"]], "Interoperability for multimodal data": [[21, "interoperability-for-multimodal-data"]], "Interoperability with other languages": [[21, "interoperability-with-other-languages"]], "Interpretation of results": [[26, "interpretation-of-results"]], "Introduction": [[4, "introduction"], [30, "introduction"]], "JavaScript": [[21, "javascript"]], "Julia": [[21, "julia"]], "Key takeaways": [[25, "key-takeaways"], [49, "key-takeaways"]], "Label harmonization": [[7, null]], "Layers": [[19, "layers"]], "License": [[30, "license"]], "Ligand-receptor inference": [[25, "ligand-receptor-inference"]], "Limitations and traps": [[17, "limitations-and-traps"]], "Limitations of Augur": [[16, "limitations-of-augur"]], "Limitations of TF regulons": [[26, "limitations-of-tf-regulons"]], "Lineage tracing": [[49, null]], "Lineage tracing technologies": [[49, "lineage-tracing-technologies"]], "Linear embedding integration using Mutual Nearest Neighbors (MNN)": [[7, "linear-embedding-integration-using-mutual-nearest-neighbors-mnn"]], "Load NicheNet Prior-Knowledge": [[25, "load-nichenet-prior-knowledge"]], "Load data": [[2, "load-data"], [5, "load-data"], [10, "load-data"]], "Loading Data": [[17, "loading-data"]], "Loading R": [[17, "loading-r"]], "Loading the complete MuData object": [[48, "loading-the-complete-mudata-object"]], "Loading the data": [[44, "loading-the-data"], [45, "loading-the-data"], [46, "loading-the-data"], [47, "loading-the-data"]], "Loom": [[21, "loom"]], "Lower bound QC thresholds": [[11, "lower-bound-qc-thresholds"]], "Manual Query": [[4, "manual-query"]], "Manual annotation": [[5, "manual-annotation"], [43, "manual-annotation"]], "Mapping ADT onto an RNA atlas with bridge integration": [[27, "mapping-adt-onto-an-rna-atlas-with-bridge-integration"]], "Mapping against different reference sequences": [[23, "mapping-against-different-reference-sequences"]], "Mapping and quantification": [[23, "mapping-and-quantification"]], "Mapping to an augmented transcriptome": [[23, "mapping-to-an-augmented-transcriptome"]], "Mapping to the full genome": [[23, "mapping-to-the-full-genome"]], "Mapping to the spliced transcriptome": [[23, "mapping-to-the-spliced-transcriptome"]], "Marker gene-based classifiers": [[5, "marker-gene-based-classifiers"]], "Markers for cluster annotations across modalities": [[12, null]], "Microfluidic device-based protocols": [[24, "microfluidic-device-based-protocols"]], "Modality prediction": [[29, "modality-prediction"]], "Model construction and training": [[16, "model-construction-and-training"]], "Modeling RNA velocity": [[51, "modeling-rna-velocity"]], "Modelling differential intercellular signalling with NicheNet": [[25, "modelling-differential-intercellular-signalling-with-nichenet"]], "Moran\u2019s I score in Squidpy": [[41, "moran-s-i-score-in-squidpy"]], "Motif sequence analysis": [[1, "motif-sequence-analysis"], [1, "id23"]], "Motivation": [[3, "motivation"], [5, "motivation"], [6, "motivation"], [7, "motivation"], [8, "motivation"], [9, "motivation"], [11, "motivation"], [13, "motivation"], [14, "motivation"], [15, "motivation"], [16, "motivation"], [16, "id10"], [21, "motivation"], [23, "motivation"], [25, "motivation"], [26, "motivation"], [27, "motivation"], [28, "motivation"], [32, "motivation"], [33, "motivation"], [34, "motivation"], [36, "motivation"], [37, "motivation"], [38, "motivation"], [39, "motivation"], [40, "motivation"], [41, "motivation"], [43, "motivation"], [44, "motivation"], [45, "motivation"], [46, "motivation"], [47, "motivation"], [48, "motivation"], [49, "motivation"], [50, "motivation"], [51, "motivation"]], "MuData attributes": [[19, "mudata-attributes"]], "MuData views": [[19, "mudata-views"]], "Multi-Omics Factor Analysis (MOFA+)": [[28, "multi-omics-factor-analysis-mofa"]], "Multi-cell resolution": [[39, "multi-cell-resolution"]], "MultiVI": [[28, "multivi"]], "Multimodal Integration": [[3, "multimodal-integration"]], "Multimodal methods": [[19, "multimodal-methods"]], "Multiome data": [[28, "multiome-data"]], "Multiple groups": [[14, "multiple-groups"]], "Nanopore single-cell transcriptome sequencing": [[24, "nanopore-single-cell-transcriptome-sequencing"]], "Neighborhood analysis": [[40, null]], "New directions": [[17, "new-directions"], [49, "new-directions"], [51, "new-directions"]], "New on-disk formats": [[21, "new-on-disk-formats"]], "New phylogenetic inference algorithms": [[49, "new-phylogenetic-inference-algorithms"]], "Nomenclature": [[21, "nomenclature"]], "Normalization": [[33, null], [47, null]], "Note on using an Apple silicon-based device": [[23, null]], "Notes on edgeR": [[14, "notes-on-edger"]], "Nucleosome signal": [[11, "nucleosome-signal"]], "Null hypotheses in gene set enrichment analysis": [[15, "null-hypotheses-in-gene-set-enrichment-analysis"]], "Number of intBCs per Tumor": [[49, "number-of-intbcs-per-tumor"]], "Observation/variable-level matrices": [[19, "observation-variable-level-matrices"]], "Observational or Variable level": [[19, "observational-or-variable-level"]], "On the effect of filtering low-expression genes": [[15, "on-the-effect-of-filtering-low-expression-genes"]], "One group": [[14, "one-group"], [14, "id21"]], "Outcome of the analysis": [[26, "outcome-of-the-analysis"]], "Outlook": [[29, null]], "Output": [[3, "output"], [3, "id8"], [3, "id14"]], "Outputs and Validations": [[17, "outputs-and-validations"]], "Overdispersion": [[33, null]], "Overview": [[24, "overview"]], "Overview of evolving lineage tracing data analysis pipelines": [[49, "overview-of-evolving-lineage-tracing-data-analysis-pipelines"]], "Overview of spatial profiling measurements": [[39, "overview-of-spatial-profiling-measurements"]], "Overview of the NGS process": [[24, "overview-of-the-ngs-process"]], "Overview of the data analysis workflow": [[9, "overview-of-the-data-analysis-workflow"]], "PCA": [[31, "pca"]], "PCA and UMAP": [[45, "pca-and-umap"]], "Paired integration": [[28, null]], "Parameter inference": [[51, "parameter-inference"]], "Partial reading of large data": [[19, "partial-reading-of-large-data"]], "Pathway and gene set collections": [[15, "pathway-and-gene-set-collections"]], "Peer-review": [[30, "peer-review"]], "Perform filtering": [[11, "perform-filtering"]], "Perturbation modeling": [[16, null]], "Plate-based protocols": [[24, "plate-based-protocols"]], "Plotting genes that were not part of the training data": [[38, "plotting-genes-that-were-not-part-of-the-training-data"]], "Pre-processing of the spatal and single-cell data": [[36, "pre-processing-of-the-spatal-and-single-cell-data"]], "Predicting CD4T responses to IFN-\u03b2 stimulation": [[16, "predicting-cd4t-responses-to-ifn-stimulation"]], "Predicting IFN-\u03b2 response for CD4-T cells": [[16, "predicting-ifn-response-for-cd4-t-cells"]], "Predicting cell type prioritization for IFN-\u03b2 stimulation": [[16, "predicting-cell-type-prioritization-for-ifn-stimulation"]], "Prediction": [[4, "prediction"]], "Preparation": [[23, "preparation"]], "Preparation and execution of cisTopic": [[8, "preparation-and-execution-of-cistopic"]], "Preparation of SCENIC": [[26, "preparation-of-scenic"]], "Preparation of the NeurIPs dataset": [[26, "preparation-of-the-neurips-dataset"]], "Prepare and explore the data": [[15, "prepare-and-explore-the-data"]], "Prepare data": [[27, "prepare-data"], [28, "prepare-data"], [28, "id9"]], "Preparing the data for lineage reconstruction": [[49, "preparing-the-data-for-lineage-reconstruction"]], "Preparing the dataset": [[14, "preparing-the-dataset"]], "Preprocessing": [[16, "preprocessing"]], "Preprocessing of gene expression data": [[37, "preprocessing-of-gene-expression-data"]], "Prerequisites": [[30, "prerequisites"]], "Prior art": [[22, null]], "Productive AIRs": [[2, "productive-airs"]], "Pseudobulk": [[14, "pseudobulk"]], "Pseudotemporal ordering": [[50, null]], "Pseudotime construction": [[50, "pseudotime-construction"], [50, "id32"]], "Python": [[7, "python"], [21, "python"], [21, "id1"]], "Quality Control": [[2, "quality-control"], [11, null], [34, null], [48, "id13"]], "Quality control": [[48, null]], "Quantification": [[23, "quantification"]], "Quantifying dynamic properties from the tree": [[49, "quantifying-dynamic-properties-from-the-tree"]], "Query mapping and imputation with Seurat\u2019s WNN": [[27, "query-mapping-and-imputation-with-seurat-s-wnn"]], "Query via Hamming Distance": [[4, "query-via-hamming-distance"]], "Query with various Strictness": [[4, "query-with-various-strictness"]], "Query-to-reference mapping": [[27, "query-to-reference-mapping"]], "Querying the trimodal reference": [[27, "querying-the-trimodal-reference"]], "Quiz": [[2, "quiz"], [3, "quiz"], [4, "quiz"], [7, "quiz"], [8, "quiz"], [13, "quiz"], [14, "quiz"], [15, "quiz"], [16, "quiz"], [25, "quiz"], [26, "quiz"]], "R": [[7, "r"], [21, "r"], [21, "id2"]], "RDS files": [[21, "rds-files"]], "RNA": [[12, "rna"]], "RNA sequencing": [[24, "rna-sequencing"]], "RNA velocity": [[51, null]], "RNA velocity inference - EM model": [[51, "rna-velocity-inference-em-model"]], "RNA velocity inference - Steady-state model": [[51, "rna-velocity-inference-steady-state-model"]], "RNA velocity inference in pancreatic endocrinogenesis": [[51, "rna-velocity-inference-in-pancreatic-endocrinogenesis"]], "Raw data": [[2, "raw-data"]], "Raw data processing": [[23, null]], "Raw data quality control": [[23, "raw-data-quality-control"]], "Read in mudata object": [[10, "read-in-mudata-object"]], "Reading and Writing of MuData objects": [[19, "reading-and-writing-of-mudata-objects"]], "Reading and writing of AnnData objects": [[19, "reading-and-writing-of-anndata-objects"]], "Reading/writing H5AD with Bioconductor": [[21, "reading-writing-h5ad-with-bioconductor"]], "Reading/writing H5AD with {Seurat}": [[21, "reading-writing-h5ad-with-seurat"]], "Reading/writing H5AD with {anndata}": [[21, "reading-writing-h5ad-with-anndata"]], "Recommended reading": [[39, "recommended-reading"]], "Reconstructing the lineage": [[49, "reconstructing-the-lineage"]], "Reconstruction of a selected tumor (3726_NT_T1)": [[49, "reconstruction-of-a-selected-tumor-3726-nt-t1"]], "References": [[1, "references"], [2, "references"], [3, "references"], [4, "references"], [5, "references"], [6, "references"], [7, "references"], [8, "references"], [9, "references"], [11, "references"], [13, "references"], [14, "references"], [15, "references"], [16, "references"], [17, "references"], [19, "references"], [21, "references"], [22, "references"], [23, "references"], [24, "references"], [25, "references"], [26, "references"], [27, "references"], [28, "references"], [29, "references"], [30, "references"], [31, "references"], [32, "references"], [33, "references"], [34, "references"], [36, "references"], [37, "references"], [38, "references"], [39, "references"], [40, "references"], [41, "references"], [43, "references"], [44, "references"], [45, "references"], [46, "references"], [47, "references"], [48, "references"], [49, "references"], [50, "references"], [51, "references"]], "Refining the detected spatial domains": [[37, "refining-the-detected-spatial-domains"]], "Repertoire comparison": [[1, "repertoire-comparison"]], "Reproducibility": [[35, null]], "Resources for developing new computational methods": [[49, "resources-for-developing-new-computational-methods"]], "Results visualization": [[8, "results-visualization"]], "Retrieving gene sets": [[15, "retrieving-gene-sets"]], "Reviewers": [[5, "reviewers"], [6, "reviewers"], [7, "reviewers"], [8, "reviewers"], [9, "reviewers"], [11, "reviewers"], [13, "reviewers"], [14, "reviewers"], [15, "reviewers"], [16, "reviewers"], [19, "reviewers"], [21, "reviewers"], [23, "reviewers"], [24, "reviewers"], [26, "reviewers"], [27, "reviewers"], [28, "reviewers"], [31, "reviewers"], [32, "reviewers"], [33, "reviewers"], [34, "reviewers"], [36, "reviewers"], [37, "reviewers"], [38, "reviewers"], [39, "reviewers"], [40, "reviewers"], [41, "reviewers"], [43, "reviewers"], [44, "reviewers"], [45, "reviewers"], [46, "reviewers"], [47, "reviewers"], [48, "reviewers"], [49, "reviewers"], [50, "reviewers"]], "Reviewers:": [[25, "reviewers"]], "Role IR in cells": [[2, "role-ir-in-cells"]], "Run differential abundance test on neighbourhoods": [[13, "run-differential-abundance-test-on-neighbourhoods"]], "Running GSEA": [[15, "running-gsea"]], "Running MuSiC": [[17, "running-music"]], "Running the model": [[3, "running-the-model"], [3, "id13"]], "Rust": [[21, "rust"]], "SCENIC": [[26, "scenic"]], "Sample-wise QC": [[48, "sample-wise-qc"]], "Save network as HTML/PNG": [[8, "save-network-as-html-png"]], "Scanpy API design": [[19, "scanpy-api-design"]], "Scanpy example": [[19, "scanpy-example"]], "Second-generation sequencing": [[24, "second-generation-sequencing"]], "Session Info": [[25, "session-info"]], "Session info": [[15, "session-info"], [27, "session-info"]], "Session information": [[7, "session-information"], [21, "session-information"]], "Setting up the Kang dataset for scGen": [[16, "setting-up-the-kang-dataset-for-scgen"]], "Setup for limma and fry": [[15, "setup-for-limma-and-fry"]], "Seurat": [[21, "seurat"]], "Shifted logarithm": [[33, "shifted-logarithm"]], "Simple formats": [[21, "simple-formats"]], "Simplified raw data processing pipeline": [[23, "simplified-raw-data-processing-pipeline"]], "Single-cell ATAC sequencing": [[9, null]], "Single-cell RNA sequencing": [[24, null], [24, "introduction-scrna-seq-key-takeaway-2"]], "Single-cell analysis frameworks and consortia": [[19, "single-cell-analysis-frameworks-and-consortia"]], "Single-cell best practices": [[30, null]], "Single-cell data resolved in space": [[39, null]], "Single-cell proteomics": [[29, "single-cell-proteomics"]], "Single-cell resolution": [[39, "single-cell-resolution"]], "Single-cell sequencing protocols": [[24, "single-cell-sequencing-protocols"]], "Single-cell specific": [[14, "single-cell-specific"]], "Single-cell vs single-nuclei": [[24, "single-cell-vs-single-nuclei"]], "Size of each tumor": [[49, "size-of-each-tumor"]], "SpaGCN": [[37, "spagcn"]], "Spatial deconvolution": [[36, null]], "Spatial domains": [[37, null]], "Spatial domains in Squidpy": [[37, "spatial-domains-in-squidpy"]], "SpatialDE": [[41, "spatialde"]], "Spatially variable genes": [[41, null]], "Specificity analysis": [[4, null]], "Spectratype": [[1, "spectratype"]], "Spectratype analysis": [[1, "spectratype-analysis"]], "Step 1. Define cell types of interest to be considered as senders/sources and receiver/targets of CCC interactions": [[25, "step-1-define-cell-types-of-interest-to-be-considered-as-senders-sources-and-receiver-targets-of-ccc-interactions"]], "Step 2. Define a set of ligands that can potentially affect receiver cell types": [[25, "step-2-define-a-set-of-ligands-that-can-potentially-affect-receiver-cell-types"]], "Step 3. Define a gene set of interest in receiver cell type(s)": [[25, "step-3-define-a-gene-set-of-interest-in-receiver-cell-type-s"]], "Step 4. NicheNet ligand activity estimation": [[25, "step-4-nichenet-ligand-activity-estimation"]], "Step 5. Infer & Visualize top-predicted target genes for top ligands": [[25, "step-5-infer-visualize-top-predicted-target-genes-for-top-ligands"]], "Stereoscope": [[36, "stereoscope"]], "Storing unimodal data with AnnData": [[19, "storing-unimodal-data-with-anndata"]], "Structure of the book": [[30, "structure-of-the-book"]], "Sub-cellular resolution": [[39, "sub-cellular-resolution"]], "Subsetting using metadata": [[19, "subsetting-using-metadata"]], "Summary": [[24, "summary"]], "Summary & Outlook:": [[25, "summary-outlook"]], "TCR data preparation": [[1, "tcr-data-preparation"]], "TCR specificity analysis": [[4, "tcr-specificity-analysis"]], "TCRdist": [[4, "tcrdist"]], "TCRmatch": [[4, "tcrmatch"]], "TESSA": [[3, "tessa"]], "TSS enrichment": [[11, "tss-enrichment"]], "Technical considerations": [[15, "technical-considerations"]], "The EM model": [[51, "the-em-model"]], "The building block of life": [[24, "the-building-block-of-life"]], "The complete alevin-fry pipeline": [[23, "the-complete-alevin-fry-pipeline"]], "The need for UMI resolution": [[23, "the-need-for-umi-resolution"]], "The steady-state model": [[51, "the-steady-state-model"]], "Theory": [[8, "theory"], [26, "theory"]], "Third-generation sequencing": [[24, "third-generation-sequencing"]], "Total Variational Inference (totalVI)": [[28, "total-variational-inference-totalvi"]], "Total fragment count and number of features": [[11, "total-fragment-count-and-number-of-features"]], "Tracing tumor development in a mouse model of lung cancer": [[49, "tracing-tumor-development-in-a-mouse-model-of-lung-cancer"]], "Training the model": [[7, "training-the-model"]], "Transcript quantification": [[24, "transcript-quantification"]], "Trimodal integration and query-to-reference mapping with multigrate": [[27, "trimodal-integration-and-query-to-reference-mapping-with-multigrate"]], "Type of errors in barcoding": [[23, "type-of-errors-in-barcoding"]], "Types of integration models": [[7, "types-of-integration-models"]], "Types of mapping": [[23, "types-of-mapping"]], "UMAP": [[31, "umap"]], "UMI resolution": [[23, "umi-resolution"]], "Uni-modal Analysis with multimodal conditions": [[3, "uni-modal-analysis-with-multimodal-conditions"]], "Unimodal data analysis with scanpy": [[19, "unimodal-data-analysis-with-scanpy"]], "Unintegrated data": [[7, "unintegrated-data"]], "Unpaired integration with Graph Linked Unified Embedding (GLUE)": [[27, "unpaired-integration-with-graph-linked-unified-embedding-glue"]], "Unstructured metadata": [[19, "unstructured-metadata"]], "Upper bound QC thresholds": [[11, "upper-bound-qc-thresholds"]], "Use zellkonverter to convert h5ad to SingleCellExperiment": [[8, "use-zellkonverter-to-convert-h5ad-to-singlecellexperiment"]], "Useful links": [[23, "useful-links"]], "Using Tangram in practise": [[38, "using-tangram-in-practise"]], "VAE integration using cell labels": [[7, "vae-integration-using-cell-labels"]], "VDJ-sequencing": [[2, "vdj-sequencing"]], "Validation on expression level": [[38, "validation-on-expression-level"]], "Variable mappings": [[19, "variable-mappings"]], "Variational autoencoder (VAE) based integration": [[7, "variational-autoencoder-vae-based-integration"]], "Variational autoencoders": [[16, null]], "View and copies": [[19, "view-and-copies"]], "Visual exploration": [[25, "visual-exploration"]], "Visualization": [[2, "visualization"], [14, "visualization"]], "Visualization of single-cell data": [[17, "visualization-of-single-cell-data"]], "Visualize top ligands & regulatory targets": [[25, "visualize-top-ligands-regulatory-targets"]], "Visualizing perturbation responses with Linear Discriminant Analysis": [[16, "visualizing-perturbation-responses-with-linear-discriminant-analysis"]], "Warning": [[5, null]], "Weighted Nearest Neighbor (WNN)": [[28, "weighted-nearest-neighbor-wnn"]], "What about the compositional effect?": [[13, null]], "What is the ground truth?": [[7, null]], "What this book covers": [[30, "what-this-book-covers"]], "What this book does not cover": [[30, "what-this-book-does-not-cover"]], "What to use as the batch label?": [[7, null]], "Who should read this book": [[30, "who-should-read-this-book"]], "Why cell-type count data is compositional": [[13, "why-cell-type-count-data-is-compositional"]], "Will batch correction remove biological differences between conditions?": [[13, null]], "With labeled clusters": [[13, "with-labeled-clusters"]], "With labeled clusters and hierarchical structure": [[13, "with-labeled-clusters-and-hierarchical-structure"]], "Without labeled clusters": [[13, "without-labeled-clusters"]], "fry test for Stimulated vs Control": [[15, "fry-test-for-stimulated-vs-control"]], "fry test for the comparison between two stimulated cell types": [[15, "fry-test-for-the-comparison-between-two-stimulated-cell-types"]], "muon API demo": [[19, "muon-api-demo"]], "mvTCR": [[3, "mvtcr"]], "scIB metrics evaluation": [[28, "scib-metrics-evaluation"]], "t-SNE": [[31, "t-sne"]]}, "docnames": ["acknowledgements", "air_repertoire/clonotype", "air_repertoire/ir_profiling", "air_repertoire/multimodal_integration", "air_repertoire/specificity", "cellular_structure/annotation", "cellular_structure/clustering", "cellular_structure/integration", "chromatin_accessibility/gene_regulatory_networks_atac", "chromatin_accessibility/introduction", "chromatin_accessibility/muon_to_seurat", "chromatin_accessibility/quality_control", "chromatin_accessibility/resources/celltype_markers", "conditions/compositional", "conditions/differential_gene_expression", "conditions/gsea_pathway", "conditions/perturbation_modeling", "deconvolution/bulk_deconvolution", "glossary", "introduction/analysis_tools", "introduction/data_infrastructure", "introduction/interoperability", "introduction/prior_art", "introduction/raw_data_processing", "introduction/scrna_seq", "mechanisms/cell_cell_communication", "mechanisms/gene_regulatory_networks", "multimodal_integration/advanced_integration", "multimodal_integration/paired_integration", "outlook", "preamble", "preprocessing_visualization/dimensionality_reduction", "preprocessing_visualization/feature_selection", "preprocessing_visualization/normalization", "preprocessing_visualization/quality_control", "reproducibility/introduction", "spatial/deconvolution", "spatial/domains", "spatial/imputation", "spatial/introduction", "spatial/neighborhood", "spatial/spatially_variable_genes", "src/lib", "surface_protein/annotation", "surface_protein/batch_correction", "surface_protein/dimensionality_reduction", "surface_protein/doublet_detection", "surface_protein/normalization", "surface_protein/quality_control", "trajectories/lineage_tracing", "trajectories/pseudotemporal", "trajectories/rna_velocity"], "envversion": {"sphinx": 62, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.intersphinx": 1, "sphinxcontrib.bibtex": 9}, "filenames": ["acknowledgements.md", "air_repertoire/clonotype.ipynb", "air_repertoire/ir_profiling.ipynb", "air_repertoire/multimodal_integration.ipynb", "air_repertoire/specificity.ipynb", "cellular_structure/annotation.ipynb", "cellular_structure/clustering.ipynb", "cellular_structure/integration.ipynb", "chromatin_accessibility/gene_regulatory_networks_atac.ipynb", "chromatin_accessibility/introduction.ipynb", "chromatin_accessibility/muon_to_seurat.ipynb", "chromatin_accessibility/quality_control.ipynb", "chromatin_accessibility/resources/celltype_markers.ipynb", "conditions/compositional.ipynb", "conditions/differential_gene_expression.ipynb", "conditions/gsea_pathway.ipynb", "conditions/perturbation_modeling.ipynb", "deconvolution/bulk_deconvolution.ipynb", "glossary.md", "introduction/analysis_tools.ipynb", "introduction/data_infrastructure.md", "introduction/interoperability.ipynb", "introduction/prior_art.md", "introduction/raw_data_processing.md", "introduction/scrna_seq.md", "mechanisms/cell_cell_communication.ipynb", "mechanisms/gene_regulatory_networks.ipynb", "multimodal_integration/advanced_integration.ipynb", "multimodal_integration/paired_integration.ipynb", "outlook.md", "preamble.md", "preprocessing_visualization/dimensionality_reduction.ipynb", "preprocessing_visualization/feature_selection.ipynb", "preprocessing_visualization/normalization.ipynb", "preprocessing_visualization/quality_control.ipynb", "reproducibility/introduction.md", "spatial/deconvolution.ipynb", "spatial/domains.ipynb", "spatial/imputation.ipynb", "spatial/introduction.ipynb", "spatial/neighborhood.ipynb", "spatial/spatially_variable_genes.ipynb", "src/lib.py", "surface_protein/annotation.ipynb", "surface_protein/batch_correction.ipynb", "surface_protein/dimensionality_reduction.ipynb", "surface_protein/doublet_detection.ipynb", "surface_protein/normalization.ipynb", "surface_protein/quality_control.ipynb", "trajectories/lineage_tracing.ipynb", "trajectories/pseudotemporal.ipynb", "trajectories/rna_velocity.ipynb"], "indexentries": {"adapter sequences": [[18, "term-Adapter-sequences", true], [18, "term-adapter-sequences", true]], "algorithm": [[18, "term-Algorithm", true]], "algorithms": [[18, "term-Algorithms", true]], "amplification bias": [[18, "term-Amplification-bias", true]], "anndata": [[18, "term-AnnData", true]], "anndatas": [[18, "term-AnnDatas", true]], "bam": [[18, "term-BAM", true]], "bam files": [[18, "term-BAM-files", true]], "bar code": [[18, "term-0", true], [18, "term-Bar-code", true]], "barcode": [[18, "term-Barcode", true]], "barcodes": [[18, "term-Barcodes", true]], "batch effect": [[18, "term-Batch-effect", true]], "benchmark": [[18, "term-Benchmark", true]], "bulk rna sequencing": [[18, "term-Bulk-RNA-sequencing", true]], "bulk rna-seq": [[18, "term-bulk-RNA-Seq", true]], "bulk sequencing": [[18, "term-bulk-sequencing", true]], "cdna": [[18, "term-cDNA", true]], "cell": [[18, "term-Cell", true]], "cell barcode": [[18, "term-Cell-barcode", true]], "cell state": [[18, "term-Cell-state", true]], "cell type": [[18, "term-Cell-type", true]], "cell type annotation": [[18, "term-Cell-type-annotation", true]], "cells": [[18, "term-cells", true]], "chromatin": [[18, "term-Chromatin", true]], "cluster": [[18, "term-Cluster", true]], "clusters": [[18, "term-Clusters", true]], "codon": [[18, "term-Codon", true]], "complementary dna (cdna)": [[18, "term-Complementary-DNA-cDNA", true]], "cpg": [[18, "term-CpG", true]], "demultiplexing": [[18, "term-Demultiplexing", true]], "directed graph": [[18, "term-directed-graph", true]], "dna": [[18, "term-DNA", true]], "doublets": [[18, "term-Doublets", true]], "downstream analyses": [[18, "term-downstream-analyses", true]], "downstream analysis": [[18, "term-Downstream-analysis", true]], "drop-seq": [[18, "term-Drop-seq", true]], "dropout": [[18, "term-Dropout", true]], "edit distance": [[18, "term-Edit-distance", true]], "fastq": [[18, "term-FASTQ", true]], "fastq reads": [[18, "term-FASTQ-reads", true]], "flowcell": [[18, "term-Flowcell", true], [18, "term-flowcell", true]], "gene expression matrix": [[18, "term-Gene-expression-matrix", true]], "hamming distance": [[18, "term-Hamming-distance", true]], "imputation": [[18, "term-Imputation", true]], "indrop": [[18, "term-Indrop", true]], "library": [[18, "term-Library", true]], "loci": [[18, "term-Loci", true], [18, "term-loci", true]], "locus": [[18, "term-Locus", true]], "modalities": [[18, "term-Modalities", true]], "mudata": [[18, "term-MuData", true]], "multimodal": [[18, "term-Multimodal", true]], "muon": [[18, "term-Muon", true], [18, "term-muon", true]], "negative binomial distribution": [[18, "term-Negative-binomial-distribution", true]], "pcr": [[18, "term-PCR", true]], "pipeline": [[18, "term-Pipeline", true]], "poisson distribution": [[18, "term-Poisson-distribution", true]], "promoter": [[18, "term-Promoter", true]], "pseudotime": [[18, "term-Pseudotime", true]], "rna": [[18, "term-RNA", true]], "rna velocity": [[18, "term-RNA-velocity", true]], "rt-qpcr": [[18, "term-RT-qPCR", true]], "sam": [[18, "term-SAM", true]], "sam files": [[18, "term-SAM-files", true]], "scanpy": [[18, "term-scanpy", true]], "scverse": [[18, "term-scverse", true]], "signal-to-noise ratio": [[18, "term-signal-to-noise-ratio", true]], "spike-in rna": [[18, "term-Spike-in-RNA", true]], "splice junctions": [[18, "term-Splice-Junctions", true], [18, "term-splice-junctions", true]], "trajectory inference": [[18, "term-Trajectory-inference", true]], "umi": [[18, "term-UMI", true]], "unique molecular identifier (umi)": [[18, "term-Unique-Molecular-Identifier-UMI", true]], "untranslated region (utr)": [[18, "term-Untranslated-Region-UTR", true]], "utr": [[18, "term-UTR", true]]}, "objects": {}, "objnames": {}, "objtypes": {}, "terms": {"": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 28, 29, 30, 32, 33, 34, 36, 37, 38, 40, 43, 45, 47, 48, 49, 50, 51], "0": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "00": [1, 3, 4, 5, 7, 11, 13, 19, 25, 26, 27, 28, 36, 37, 38, 40, 41, 49, 51], "000": [2, 3, 5, 7, 13, 23, 24, 26, 32, 49], "0000": [3, 13, 25], "00000": [3, 25], "000000": [3, 7, 13, 17, 19, 25], "000001": 25, "000002": [4, 15, 25], "000003": [17, 25], "000006": 17, "000007": 17, "000008": 25, "00001": 25, "000017": 4, "000019": 17, "000023": 4, "000065": 17, "000066": 17, "000072": 17, "000076": 17, "000086": 17, "000091": 17, "000093": 41, "000099": 41, "0000e": 27, "000122": 17, "000125": 17, "000131": 41, "0001382038": 7, "000156": 17, "000160": 17, "000170": 17, "000200": 17, "000212": 17, "000219": 17, "000221": 17, "000247": 17, "000262": 15, "0002657828": 7, "000309": 17, "000328": 17, "000353": 17, "000354": 17, "00036": 27, "000370": 17, "000379393": 7, "000380": 17, "000393": 17, "000399": 17, "000412": 17, "000414": 17, "000422": 17, "000425": 17, "0004299227": 7, "000430": 17, "00044": 27, "000454": 17, "000457": 17, "000468": 17, "000483": 17, "00050": 27, "000504": 17, "000516": 17, "0005365199": 7, "000577": 17, "00058": 27, "000586": 17, "000594": 17, "000648": 17, "00065": 27, "000733": 17, "000744": 17, "000744047619047619": 37, "000750": 17, "000761": 17, "000781": 17, "000785": 17, "000795": 17, "0007981117": 7, "000801": 17, "000825": 11, "00082514": 11, "0008381943": 7, "0009021682": 7, "000911": 17, "000919": 17, "000936": 17, "000945": 17, "000954": 17, "000e": 40, "001": [17, 24, 26, 37, 38], "001041": 17, "001109391": 7, "001152": 49, "001153": 17, "001174": 17, "001175": 17, "001177": 17, "001213": 17, "001298": 17, "0013": 21, "001302": 17, "001318": 17, "001326": 17, "001406": 17, "001537": 17, "001551": 17, "00157": 50, "001589": 14, "001641": 41, "001676": 17, "001680": 17, "001693": 41, "001739": 41, "001748": 41, "001784": 17, "001793": 17, "001799": 17, "001814": 17, "001871": 7, "001998": 16, "002": [2, 13, 23, 24, 27, 36, 38, 44], "002024": 17, "002113": 17, "002119": 17, "002153635": 7, "002156": 17, "002171": 17, "002195": 17, "002209": 17, "002286": 17, "002291": 17, "002296": 17, "002298": 17, "002305526": 7, "002317": 17, "00233": 27, "002331": 16, "002371": 17, "002390": 17, "002456": 17, "002554": 47, "002572e": 17, "00258": 27, "002595": 13, "002626": 17, "00266": 38, "002712": 14, "002719": 17, "00273": 27, "002739": 17, "002818": 17, "002869": 17, "002915": 15, "00292": 25, "002960": 17, "003": [2, 23, 30], "003021": 17, "003037": 17, "003172": 36, "003196878": 7, "003224": 17, "003329": 17, "003351e": 15, "003378": 17, "003379": 17, "00340": 28, "003435": 17, "003446": 17, "003457": 36, "003507": 17, "003632830": 7, "003656": 17, "003657": 17, "003669": 41, "003723": 41, "003772": 17, "00381": 27, "003820": 17, "003832": 17, "003837952": 7, "003925": 17, "003949": 17, "004038": 41, "004070": 17, "004111": 17, "004145": 15, "004153": 17, "004242": 17, "004296": 17, "004478": 17, "004530": 17, "004607": 17, "004650": 17, "004655": 17, "004663": 14, "004735": 17, "004801": 17, "004823": 17, "004873": 17, "004921": 17, "004927": 17, "005": [23, 24, 27, 37, 38, 50], "00512": 9, "005149": 17, "00515": 39, "005165": 17, "005200": 17, "005269": 17, "005295": 7, "005392": 17, "005433": 17, "005464": 17, "005490": 17, "0055208620": 7, "005524": 17, "005578": 15, "00561": 16, "005645": 17, "005755797": 7, "005848": 17, "00586": 30, "005951634": 7, "006": [17, 27], "006030": 17, "006261": 17, "0063": 9, "006337": 17, "0063816143": 7, "006430": 36, "006444": 17, "006472": 17, "006533": 7, "006566": 17, "006685": 17, "006749": 17, "006784": 25, "006798": 17, "0068": 50, "007": [25, 27], "007052": 13, "007055": 36, "007094": 25, "0071": 50, "007149": 17, "007268": 25, "007273": 17, "007285": 25, "0073": 24, "007331": 14, "007348": 17, "007417": 17, "0075": 37, "007564": 25, "007645": 17, "007646": 17, "00769": 49, "007700": 17, "007707": 36, "007733": 25, "007761": 25, "00778": 16, "007855": 25, "00790": 9, "007911": 17, "008": 34, "008009": 17, "008010": 17, "00803": 13, "0082": 2, "00830": 36, "008307": 17, "008431": 17, "008490": 17, "008506": 17, "008620": 36, "008648": 17, "008649": 25, "00870": [23, 51], "008748": 25, "00874999999999": 37, "008824": 17, "008826": 17, "008832": 17, "008907": 25, "00895": 7, "008957": 17, "009015": 25, "009087": 36, "009102": 17, "009149": 17, "009212": 17, "00927": [48, 50], "009382408": 7, "009437": 7, "009512": 17, "0095352521": 7, "009583": 41, "00965": 24, "009778": 17, "009929": 17, "00it": 4, "01": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 36, 37, 39, 40, 41, 47, 48, 49, 50, 51], "010": [23, 40], "010006": 17, "01001": 5, "010049": 14, "010065": 25, "010111": 25, "010171": 17, "01018986": 40, "0102285085": 7, "010231": 36, "01033": 13, "010418": 17, "01050": [27, 28], "010565": 17, "010730e": 17, "010780": 17, "010830": 13, "010837": 17, "010936": 16, "010955783": 7, "010972": 17, "0109928448": 7, "011": [2, 17], "011042": 17, "011122931": 37, "011133475": 7, "011144": 17, "011156": 17, "011228": 17, "011261": 17, "0113": 7, "01139": 36, "011393": 17, "0114": 17, "01143158": 7, "011449": 17, "011488e": 41, "011544715": 7, "011891": 17, "011961": 17, "012": [5, 7, 13, 24], "012059": 17, "01206": 7, "0121073040": 7, "01227": 7, "012439": 17, "01247": 36, "012580": 25, "012603": 13, "012610": 17, "01264": 38, "012677": 17, "01272": 36, "012727": 17, "01284": 27, "012894": 17, "012962": 17, "013": 13, "013065": 17, "013067": 25, "013183394": 7, "013188": 17, "013241": 17, "013295": 14, "013301": 17, "013302": 17, "013317": 17, "0133178897761": 37, "013332": 17, "013337": 17, "01336": [7, 28], "01346": 51, "013523": 17, "013575": 17, "01358": [19, 37, 40, 41], "013670": 17, "013744": 17, "013826": 36, "013858992": 7, "0139047071": 7, "0139905515": 7, "014": [1, 2, 4, 13, 14, 48], "014011": 17, "01408": 51, "014090": 17, "014266": 17, "014339": 36, "014482": 17, "014647": 17, "01480": [36, 38], "014837": 17, "014846": 17, "015": [5, 14, 17, 23, 24], "015055": 17, "015060": 17, "015091": 17, "015157": 17, "015228": 17, "015318": 17, "015371": 17, "015419": 17, "015445186": 7, "015501": 3, "015595": 17, "015624": 17, "015769": 17, "015810": 17, "015843": 17, "015938": 17, "016": [24, 39, 48], "016110": 17, "0162": 7, "016462": 17, "016581": 17, "016660": 17, "0169": 21, "017": [17, 19], "0171909615": 7, "017265": 36, "017268": 17, "017479": 17, "017518": 17, "017529": 17, "017618": 17, "017720": 17, "017742": 17, "017743": 17, "017747": 17, "01777767": 7, "017800": 36, "017824": 17, "017958": 17, "018": [2, 7, 9, 16, 23, 24, 44, 49, 50, 51], "018025385": 7, "018073": 17, "01814": 33, "018144": 17, "018155": 17, "018158": 17, "0183198213": 7, "018500": 17, "018764": 17, "018820e": 15, "018999": 16, "019": [5, 6, 7, 9, 11, 13, 14, 16, 17, 22, 23, 24, 25, 31, 32, 41, 44, 50, 51], "019028": 36, "019050": 17, "01905311": 40, "019102": 17, "019180": 15, "019181": 17, "019282": 17, "019290": 17, "019330": 17, "019351": 17, "019374": 36, "019886": 17, "019928": 11, "01it": 4, "01m": 7, "02": [1, 4, 7, 13, 14, 17, 21, 24, 25, 27, 38, 40, 41, 51], "020": [5, 7, 13, 14, 16, 23, 24, 25, 27, 28, 32, 33, 34, 36, 50, 51], "02015": 28, "020330": 17, "02040172": 7, "020538": 17, "020691": 13, "02071": 23, "020842": 17, "020848": 17, "0209648": 24, "020e": 40, "021": [5, 7, 9, 11, 13, 14, 16, 19, 23, 24, 25, 28, 30, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "02100047": 40, "021004": 13, "02116382": 11, "021283": 17, "021311": 17, "021337": 17, "021343": 17, "02136": [32, 33, 34], "021414": 17, "021438": 17, "021531": 17, "021775": 17, "022": [5, 9, 14, 25, 27, 36, 38, 39, 41, 47, 49, 50, 51], "022174": 36, "022198": 17, "022236": 17, "02224": 13, "022288": 17, "022354": 17, "022406": 17, "022560136": 7, "022603": 17, "02269": 38, "022855": 17, "0229": [7, 44, 49], "023": [5, 13, 30, 33], "023071": 7, "02312621": 40, "0232357011": 7, "023237586": 7, "02327": 5, "023478": 17, "023484": 17, "02366670": 7, "023929": 17, "024": 4, "02404": 41, "024063": 17, "02414": 51, "024230": 17, "024462": 7, "024532": 17, "024641": 17, "02469": 11, "025": 13, "025152": 17, "02519": [23, 30, 34], "025195": 17, "025210": 17, "025247": 17, "025266": 17, "025306": 41, "0254": 7, "025445": 21, "025473": 17, "02552": 23, "025538": 17, "025631": 17, "025682": 14, "025715": 17, "025763467": 7, "02577": [19, 48], "025812": 17, "026012": 36, "026051": 36, "026074": 17, "026425": 17, "026449": 11, "026496": 17, "026507": 17, "026611": 17, "026912": 36, "027": [4, 13], "027290": 17, "027294": 17, "027501": 17, "027782": 17, "02783": 25, "028101": 17, "028191": 11, "02819141": 11, "028242": 17, "028406": 17, "028456": 7, "028745": 17, "028784": 17, "028895": 17, "029": 2, "029131": 17, "0292": 25, "029331": 17, "029334": 17, "029488": 36, "029637": 17, "029776": 17, "02_clonotyp": 4, "03": [4, 5, 7, 9, 15, 21, 23, 25, 27, 28, 36, 40, 41, 48, 50], "030": [4, 13], "030072": 17, "030433": 17, "030663e": 15, "030714": 7, "030763": 17, "031": [5, 7], "031009": 17, "031298": 17, "0313151274": 7, "031351": 17, "031499": 17, "031523": 17, "031593": 17, "031727": 41, "0317359576": 7, "03175": [39, 41], "031832": 14, "031883": 17, "031902": 17, "031905": 17, "031938502": 7, "032441": 17, "032812e": 7, "032995": 17, "033144": 36, "033312": 17, "033652": 41, "033807": 13, "033820": 17, "0341661907": 7, "034702669886504146": 3, "034764": 17, "034838": 17, "035044": 17, "035206": 17, "035495": 17, "035848768": 7, "035979": 17, "036": [2, 44], "036180": 17, "036258": 17, "036429": 17, "036592": 17, "0367": 9, "036719": 17, "036769": 41, "036793": 17, "03693412": 40, "036951": 17, "037": 2, "037017": 17, "037059": 7, "037080": 17, "037086": 36, "03708733": 40, "037690": 17, "037749": 17, "037775": 17, "037869": 17, "03793": 5, "038": 13, "038030": 17, "038063": 17, "038076743": 7, "038107": 17, "038413": 17, "038598": 17, "038787": 17, "038888": 36, "039": [2, 27], "039067": 17, "039231": 17, "03929": 50, "0394717101": 7, "0398862297": 7, "03it": [4, 19], "04": [4, 5, 7, 8, 9, 13, 14, 15, 17, 19, 21, 22, 23, 24, 25, 27, 28, 47, 48], "0400": 25, "040034": 36, "040259": 36, "040401": 17, "040612": 36, "040700": 17, "040736": 17, "040750": 17, "040768": 17, "040867": 17, "040876": 17, "040e": 40, "041": [17, 27], "04109503": 40, "041130": 25, "041143": 13, "041302": 36, "041347": 17, "0414": [50, 51], "0416": 25, "04166": 51, "041832": 14, "042": 27, "0428727350273357e": 3, "043106": 7, "043131": 17, "043424": 41, "044": 24, "04440": 21, "044578": 17, "044600": 36, "04489": 13, "044896": 17, "045": [1, 2], "045312": 17, "045383": 17, "04541": 5, "045437": 17, "045462": 17, "045747": 36, "045796": 17, "046026e": 15, "046150": 17, "0461501": 40, "046156": 17, "0465": 24, "0469": 24, "04695830342547": 37, "047328": 17, "047461e": 15, "047486": 7, "047501": 17, "047504": 14, "0477": 25, "047839": 17, "048": [5, 14, 19, 27, 28], "048005": 36, "048209": 16, "048237": 17, "048438": 17, "048755": 17, "048820": 17, "04918": 25, "04922": 49, "0494": 7, "049647": 17, "04it": 25, "05": [1, 3, 4, 5, 7, 8, 9, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 27, 28, 37, 41, 44, 47, 48, 49, 50, 51], "0503999": 40, "05046": 50, "05060": 36, "0508": 25, "051093": 36, "051506": 7, "051597": 17, "052031": 17, "052365": 17, "052478": 17, "0527": 25, "0528": 2, "0529": 5, "052970708": 7, "053040": 17, "053345": 36, "0534": 25, "0535": 5, "053514": 17, "053946": 16, "054": 13, "054286": 17, "054419895": 7, "054454": 17, "054697": 14, "0550": 14, "055291e": 15, "055324": 36, "055596": 17, "055801": 36, "056105": 13, "05617137": 7, "056218": 17, "056370": 17, "056550": 17, "056698": 41, "056839": 17, "057": 13, "057406": 17, "057679": 7, "0578": 25, "058150": 13, "058162": 36, "058451": 16, "058535": 17, "0586": 25, "058816": 17, "059066": 17, "0591": [50, 51], "059664": 36, "06": [2, 4, 5, 7, 14, 17, 21, 25, 27, 41, 49, 51], "060": [2, 13], "060012": 15, "060052": 17, "060295": 17, "060488": 17, "0605": 16, "060557e": 41, "0609319ns_pass": 10, "061": 27, "061176": 17, "061238": 27, "061254": 17, "061422": 41, "061855": 36, "0619": [7, 44], "062": [13, 44], "062043": 17, "062383": 25, "062643e": 41, "062904": 17, "06307772": 7, "063412": 11, "06341238": 11, "0634131457": 7, "063421": 17, "063592": 17, "063762": 25, "063919": 17, "064": [1, 4], "064095": 36, "064172": 17, "064833e": 15, "0654": [22, 24], "065401e": 41, "066": [1, 14], "066143": 13, "0662": 25, "066304": 17, "0667": 25, "06673556": 40, "067": 1, "067159": 14, "0678": 25, "067906": 17, "0684": 23, "069194": 17, "0694": 25, "069586": 36, "069872": 38, "06e": 16, "07": [2, 3, 4, 5, 7, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 41, 44, 51], "0701": 41, "07013584": 7, "070147": 25, "070524": 25, "07070432": 40, "071": 13, "07143": 21, "071472": 36, "071492": 17, "071568": 17, "071622": 17, "07165": 21, "071987": 13, "072006": 17, "072228": 17, "07226": 25, "072739": 25, "073": 13, "073604": 13, "073787": 17, "073812": 25, "07394278049468994": 37, "07412227": 40, "0745": 25, "074556": 25, "074642": 25, "074791": 25, "075": 2, "075350": 25, "0755": 25, "075502": 25, "0765": 25, "076776": 7, "076892": 36, "077152": 25, "078150": 47, "078486": 25, "0786": 25, "078720": 17, "078934": 13, "078945": 25, "079524e": 14, "079577": 17, "07959": 25, "079590": 17, "079864e": 7, "07it": 25, "08": [1, 3, 4, 7, 11, 13, 15, 17, 19, 21, 25, 26, 28, 29, 37, 41, 51], "080234e": 15, "0803": 25, "080626": [17, 25], "080e": 40, "0812": 25, "081810": 17, "082": 23, "082027580": 7, "082158": 36, "082315": 25, "082443": 17, "082823": 36, "083236": 17, "083241": 36, "083460": 13, "084": 13, "0844": 14, "084500": 7, "084937": 17, "085": [2, 13], "0856": 25, "085672": 17, "085893": 17, "086": 13, "0864": 25, "086884": 17, "087671": 17, "087746": 36, "087951": 17, "088082": 17, "088092": 17, "0882": 25, "088418": 3, "08937": 13, "08it": 4, "09": [1, 4, 5, 7, 9, 13, 15, 17, 21, 23, 25, 27, 28, 36, 38, 41, 50], "090": 13, "090013": 17, "090483": 17, "090575": 17, "091188": 17, "091884": 25, "09205304": 40, "092170": 17, "092188e": 25, "0935": 50, "094": 13, "0941": 25, "09498141": 40, "095742": 17, "095896": 17, "096202": 16, "096780": 16, "0969": 23, "096936": 17, "097204": 17, "097628": 17, "098": 13, "098612": 19, "0994335574766187e": 3, "099594": 17, "09990": 17, "0m": [3, 5, 7, 16, 27, 28, 50], "0x124cf9c30": 13, "0x125a9ec30": 13, "0x1265f3c30": 13, "0x1278c5c30": 13, "0x127cb9c30": 13, "0x129969c30": 13, "0x12ad09c30": 13, "0x12ee9ac30": 13, "0x12f0f1c30": 13, "0x12f11cc30": 13, "0x131710c30": 13, "0x131764c30": 13, "0x132a2ec30": 13, "0x1343f7c30": 13, "0x13455ec30": 13, "0x13a4136b0": 13, "0x13b1576b0": 13, "0x13bdb76b0": 13, "0x13d0326b0": 13, "0x13d4106b0": 13, "0x13f0d36b0": 13, "0x1404af6b0": 13, "0x1446806b0": 13, "0x1448ce6b0": 13, "0x146e806b0": 13, "0x146ee86b0": 13, "0x1481d76b0": 13, "0x149ba86b0": 13, "0x149c2f6b0": 13, "0x160630220": 48, "0x16070be50": 48, "0x1607a2550": 48, "0x160aa2f70": 48, "0x16af6f460": 48, "0x17bed0340": 48, "0x18a243040": 21, "0x18ef5ec30": 13, "0x19ad2cd90": 13, "0x19be736b0": 13, "0x7f6f9a129280": 28, "0x7fc377ccce10": 26, "0x7ff53cc2e2b0": 1, "1": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "10": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "100": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 16, 19, 21, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 42, 47, 49, 50], "1000": [3, 7, 11, 13, 16, 19, 23, 24, 25, 30, 34, 36, 37, 40], "10000": [1, 7, 8, 13, 24, 27], "100000": [7, 11, 48], "1000000": 19, "100006224": 8, "100006224100006224": 8, "100008": 48, "100009": 2, "1000px": 42, "1001": 50, "100182": 9, "1002": [6, 24, 48], "10026": 3, "100344": 50, "1005": [21, 41], "100699": 34, "1007": [5, 7], "100954": 17, "100bp": 11, "100e": 40, "100k": 13, "100x2000": 19, "101": [8, 23, 26, 37, 49], "1010": 48, "1010031": 51, "10112": 11, "10115791": 40, "1012": 4, "1015": 5, "1016": [5, 7, 14, 17, 19, 23, 24, 25, 26, 27, 28, 30, 34, 39, 48, 50], "101973": 25, "102": [2, 15, 27], "1023": 13, "1023818214614": 13, "102628": 14, "10270": 7, "10270x13431": 7, "10272": 11, "1028": 2, "103": [8, 25, 27, 28, 36], "10331": 27, "1038": [2, 5, 6, 7, 9, 13, 14, 16, 17, 19, 22, 23, 24, 25, 27, 28, 30, 31, 33, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "104": [13, 25, 40], "1045": 47, "104626": 36, "10465": 27, "104858": 17, "105": [4, 8, 49], "1053": [5, 7, 40, 44, 49], "10561": 4, "1056489": 50, "1058": [5, 7, 44, 49], "106": [1, 7, 11, 25, 27, 28, 36, 49], "1064": 49, "10648": 11, "10665270050081478": 23, "107": [8, 49], "1072": 49, "10726": 38, "1073": [13, 24, 51], "107962": 15, "108": [13, 25, 49], "1080": 40, "1083": [15, 26], "108395": 2, "1084": 6, "1086": [15, 26], "108737e": 14, "1088": [6, 25], "108887": 17, "10889": 1, "1089": [16, 23], "109": [1, 8, 25, 27, 37, 49], "1090": 47, "109078": 17, "10915": 4, "10919": 4, "1093": [2, 4, 5, 7, 9, 14, 17, 19, 23, 25, 34, 36, 38, 41, 47], "1096": 6, "109806": 17, "109896": 13, "10e3": 11, "10e4": 11, "10px": 42, "10th": 23, "10x": [2, 3, 5, 6, 7, 9, 11, 14, 16, 19, 23, 24, 28, 34, 36, 37, 38, 39, 40, 41, 49], "10xg19": 3, "10xgenom": [2, 23, 37], "10xv3": 23, "11": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 47, 49, 50, 51], "110": [13, 49, 50], "11000": 13, "1101": [5, 7, 9, 13, 14, 19, 23, 25, 27, 28, 29, 37, 41, 47, 48, 50, 51], "1102": [7, 27], "1103": 24, "110367e": 17, "110393": 25, "11049": 24, "1107": 21, "110882": 50, "1109": 50, "111": [1, 5, 8, 13, 16, 25, 28, 49], "111008": 17, "1111": [13, 14], "111433": 17, "111516": 17, "112": [7, 13, 24, 25, 27, 49], "11238": 16, "112478": 17, "1126": [5, 17, 25, 50, 51], "11260235": 40, "1129": 25, "11290": 7, "112m": 21, "113": [8, 27, 49], "113m": 21, "114": [13, 27, 48], "1140": 40, "114149766": 7, "11432": 26, "1145": [5, 6, 50], "114610": 17, "115": [8, 19, 22, 25, 27, 49], "1150": 23, "11501": 1, "1151": 50, "11522": 4, "115270": 11, "1156": 50, "1158": 23, "1159": 14, "115m": 21, "116": [2, 13, 25, 49], "1160": [1, 5, 6, 26, 50], "116168": 11, "116394": 21, "116434": 43, "116490": 7, "1167": 50, "116715": 48, "117": [8, 27], "11725": 36, "117283": 17, "118": [7, 13, 25, 27], "118563": [47, 48], "1186": [2, 5, 6, 7, 11, 13, 14, 16, 17, 19, 23, 24, 25, 28, 30, 32, 33, 34, 41, 48, 50, 51], "1187": 24, "1188": [21, 27, 28], "11889": 21, "118m": 21, "119": [5, 8, 15, 49], "1191": 14, "1192": 21, "1193": 49, "11956": 34, "1197": 24, "119837": [44, 45, 46], "119886875152588": 37, "12": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 34, 36, 38, 39, 40, 43, 44, 48, 49, 50, 51], "120": [1, 4, 23, 40, 48, 49], "1201": 24, "1202": [21, 23, 24], "120502": [27, 28, 43, 46], "12054": 16, "1209": 21, "121": [4, 5, 8, 13, 19, 22, 25], "121110e": 14, "1214": [23, 24], "1218": 14, "1219": 21, "12198": 16, "122": [48, 49], "122016": 48, "1221": 21, "122208": 17, "12268": 14, "122690": 36, "1228": 19, "123": [8, 15, 26, 27, 28, 34], "1230": 21, "12301": 25, "1231": 21, "123245": 25, "1233": 21, "1234": 13, "123504": 25, "123505733": 7, "12362": 4, "12363": 4, "12364": 4, "12365": 4, "12366": 4, "12367": 4, "123673": 21, "124": [2, 25, 48], "1240": 21, "1242": 51, "12427134": 11, "1243": 14, "1246": [21, 48, 50], "1249": 49, "125": [8, 13, 37], "1250": [11, 24], "1251": 3, "1253": 49, "125658": 37, "125729": 17, "1258": [48, 50], "1259": 3, "126": [13, 27], "126003": 13, "126119": 7, "126146": 21, "1262": 21, "1263": 21, "1264": 21, "126413": 19, "126426": 13, "1265": 21, "1268": 21, "126846": 14, "12688": [5, 6, 7], "127": [7, 8, 13, 25, 26], "1270": 21, "1274": 21, "127703": 36, "128": [7, 16, 40, 48, 49], "128015": 17, "1281": 14, "128496": 21, "128713": 17, "1289": [21, 44], "129": [7, 8, 25, 27, 50], "1290": 40, "1292": 4, "1293": 4, "1296": [21, 44], "129921": [7, 26], "12it": [4, 5], "13": [1, 2, 3, 4, 5, 7, 8, 13, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 36, 37, 40, 41, 47, 49, 50], "130": [2, 5, 24, 25], "1304975216": 49, "13056": 31, "131": [7, 8, 13, 27], "131391": 17, "13157661": 40, "1317": 17, "132": [13, 16, 27, 38], "132153e": 41, "13236": 25, "13237": 25, "13238": 25, "13239": 25, "13240": 25, "1326": 4, "132748287": 37, "132763": 17, "132866": 36, "133": [8, 25], "1330": 40, "13319079238387194": 1, "133349": 17, "13344": 13, "133453": 7, "1337": 9, "133780e": 17, "133848": 17, "133m": 21, "134": [3, 49], "13407": 13, "13408": 13, "13409": 13, "13410": 13, "13411": 13, "13414": 13, "1342": [37, 41], "13431": [7, 8, 26], "13432": 8, "1344": 40, "1349": 17, "13490": 13, "13492": 13, "135": [4, 8, 13, 27], "1351": [37, 41], "1352": [38, 40], "13548": 11, "136": [25, 27, 28, 43, 45, 48], "1360": 36, "1362": 38, "1363": [15, 26], "1364": 24, "13660": 13, "136754": 25, "1369": [36, 50], "13699": 13, "137": [8, 22, 49, 50], "13702": 4, "137064": 15, "13708": 17, "1371": [24, 51], "1375": [15, 26], "13757": 13, "137689": 17, "137952e": 15, "138": [17, 23, 49], "1382": [19, 40], "1387": 26, "139": [8, 13, 14, 23, 25], "139282": 41, "1396": 49, "13it": 4, "14": [1, 2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 16, 21, 23, 24, 25, 26, 27, 28, 36, 37, 40, 44, 47, 48, 49, 50], "140": [13, 14, 16, 38, 40, 44, 46, 47, 48], "1401": 49, "14049": [23, 24], "1408": [50, 51], "1409": 49, "140e": 40, "141": 8, "141245": 21, "1413": 21, "1414": [50, 51], "14141": 17, "1416": 21, "14171": 1, "14172": 1, "14173": 1, "14174": 1, "14175": 1, "14176": 1, "14177": 1, "14178": 1, "14179": 1, "14180": 1, "14181": 1, "1419": [17, 26], "141ab989ae794394fb6c441d50c0ea6771f96a8d048a8a4c400c10dba267b97c": 2, "142": [13, 24, 25, 27], "14239": 13, "142890": 47, "143": [4, 8, 13, 26], "143153": 13, "143267": 25, "14327": 13, "143465e": 17, "14348": 13, "14348115": 7, "14356": 13, "14364": 36, "1438": 49, "144": [2, 3, 13, 26, 27], "1440": [17, 26], "144075e": 7, "144218": 16, "1444": 14, "144852": 17, "145": [8, 22, 23, 25, 40], "14518": 17, "14530it": 1, "145556": 16, "1457": 27, "145847": 25, "146": [13, 27, 49], "14603": 17, "147": [8, 27], "1471": 17, "14710": 10, "147686": 25, "147717": 25, "14772134": 40, "148": [13, 25], "14814": 34, "1484": 25, "148463": 17, "1488": 49, "1489": 2, "149": [8, 13, 49], "14950": 17, "149544e": 14, "149598e": 25, "1498": 49, "14seuratproject": 10, "14seuratproject1409": 10, "14seuratproject166610777110336051052495336171123": 10, "14seuratproject170410836993326850612450326969953": 10, "14seuratproject170711283588179727381409179935913": 10, "15": [1, 2, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 41, 43, 44, 49, 50], "150": [2, 4, 13, 14, 19, 23, 48, 49], "1500": [1, 3, 11, 48], "15000": [11, 19], "150000": 11, "15000000000000002": 3, "1506": 25, "1507125112": 24, "151": [8, 13, 14, 25, 49], "151255": 25, "151268": 41, "1513": 25, "1517": 24, "152": [13, 27], "1520": 24, "15215": 13, "15223": 13, "15240": 34, "152494": 17, "15252": [7, 14, 22, 29, 50, 51], "15256": 13, "15286": [11, 17], "153": 8, "15339": 11, "1536": 4, "153601547": 7, "15377": 11, "15386": 11, "153936": 2, "154": [2, 27], "154015": 11, "154027": 11, "15434": 17, "15443": 4, "1546": 49, "15474": 25, "155": [8, 13, 27, 30], "155074": 15, "15534039": 11, "15545": 15, "15550": 15, "155726": 17, "1558": 49, "155918": 16, "15596521": 4, "156": [23, 27], "1564": 11, "15666": 6, "156763": 25, "157": 8, "15701": [14, 25], "15706": [14, 15, 16], "15735": 17, "157825": 17, "158": [13, 27], "15809": 6, "15843296": 40, "158681": 25, "159": [4, 8, 13, 25, 27, 51], "159185": 2, "159446": 2, "159738": 14, "15d": 49, "15k": 11, "15m": 21, "15px": 42, "16": [1, 2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 34, 36, 37, 44, 47, 49, 50, 51], "160": [7, 13, 40], "1600": 36, "160046": 17, "1603": 16, "16046": 27, "16065": 34, "161": [13, 23, 24, 25, 27, 28], "1610": 3, "1614": 14, "16184": 17, "162": [7, 21, 25, 26], "1621": 16, "162105": 36, "162173": 17, "162506": 28, "1627": [17, 28], "1628": 28, "16294": [27, 28], "162945": 15, "163": [2, 4, 7, 23, 24, 27], "16311": 28, "16381548": 40, "164": [13, 27], "1640": 17, "16458": 17, "16483": 11, "164895": 17, "164m": 21, "165": [13, 27, 48], "16520": 17, "165263": 17, "16534": 17, "165866e": 25, "166": [13, 23, 24, 27, 36, 49], "166156": 17, "16621": 17, "1663": [6, 50], "1665": 24, "167": [27, 49], "1670": 51, "1676": 14, "167809": 21, "1679": [7, 26], "168": [25, 27, 30, 49], "168599": 21, "16863": 17, "16875": 17, "16877": 11, "169": [27, 49], "1690": 4, "16907": 17, "16934": [11, 34, 48], "169340000": 11, "1694": 34, "16953": 1, "1696": 11, "16k": 11, "16m": 21, "16min": 15, "17": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 21, 22, 23, 24, 25, 26, 27, 36, 37, 40, 41, 47, 48, 49, 50], "170": 51, "17000": 24, "1704": 14, "17041": 13, "170412": 17, "171": [2, 19, 25, 26, 27, 37, 40, 41], "17115": 17, "1716": 16, "1718": 23, "172": 27, "17235": 17, "17237": 17, "17243": [27, 28], "17247": 17, "17251": 17, "1727": [17, 23], "17274": 17, "172740e": 7, "1728": 25, "173": [13, 27], "17301353": 40, "173036": 7, "17318": 17, "17353": 17, "17376": 11, "1738": 14, "173849": 51, "17387": 17, "1739": 15, "17396": 17, "174": 13, "1740": 15, "1742": [6, 23], "17429": 17, "174486e": 17, "175": [27, 49], "1750": 11, "17513": 17, "1752": 23, "17526": 17, "175727": 17, "1758": [1, 34], "176": [7, 34, 37, 49], "17604": 17, "176318": 13, "17662": 17, "177": [7, 15, 27], "1771": [7, 26], "17736": 17, "177582": 17, "1777": 37, "17774": 17, "1778": 24, "178": [19, 27, 37, 40, 41], "17800": 24, "17865": 17, "1792": 37, "17922": 17, "1795": 5, "17966": 38, "1797": [8, 26], "17987": 17, "179935913": 10, "179994e": 17, "17it": 36, "17m": 21, "18": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 37, 38, 40, 41, 44, 49, 50, 51], "180": 25, "18009": 17, "1805": 16, "18078": 37, "180847": 17, "1809": 17, "1809919733": 7, "180deg": 42, "181": 13, "181107": 11, "18118": 17, "1814847": 40, "1815": 1, "181768": 11, "181982": 17, "182": [4, 17, 26, 27], "18223": 17, "182253e": 7, "1824": 7, "18250": 17, "1829": 23, "183": 27, "1830": 11, "1836": 23, "183673": 21, "1839": 24, "18390": 17, "183973": 11, "184": [5, 13, 27, 28, 41, 48], "18432": 17, "184845": 11, "184m": 21, "185": [5, 27, 37, 49], "1850": 7, "1854": 11, "1857": 14, "18579912": 40, "18585": 17, "185917": 19, "18598": 17, "186": [13, 26], "186098": 14, "1861": 32, "18646": 17, "18649": 16, "186743": 17, "18675": 17, "1869": 24, "187": 27, "18701": 17, "18756": 17, "18776": 16, "18786": 17, "188": [2, 25, 27], "188391": 25, "1888": 7, "189": [27, 48], "18906": 11, "1898": 21, "18e": 13, "18m": 21, "18px": 42, "19": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 36, 37, 38, 40, 41, 43, 44, 49, 50, 51], "190": 13, "1902": 7, "19034": 2, "1904": 13, "1905": [38, 49], "190628": 11, "191": 13, "191237": 11, "1917": 17, "191832": 17, "192": [13, 27], "1920": 25, "192111": 11, "1923": 49, "1926": 14, "1929": 25, "193": [2, 13, 27, 41], "1930": 1, "1932": 1, "1933": 21, "1938": 33, "194": [5, 27, 34], "19402": 4, "1941": 21, "19469": 17, "1947": [14, 21], "195": 13, "1950": 34, "1953": 24, "1957": 31, "1958": [21, 49], "196": 27, "1960": 21, "1963": 49, "1965": [21, 24], "196633": 11, "1967": 50, "1969": 21, "196957": 2, "197": 1, "1970": 49, "19711": 48, "1972": 24, "197475": 17, "1979": 41, "198": [13, 27], "1981": 49, "1982": [13, 50], "1983": 49, "1987": [24, 49], "1988": 4, "199": [27, 49], "1991": 49, "1992": [4, 23], "1995": 14, "1996": 24, "19965825": 40, "1997": 23, "1998": [5, 21], "1999": 21, "19d": 49, "1_contig_1": 2, "1_contig_2": 2, "1a": 14, "1b": 14, "1b9e77": 7, "1d": 49, "1donor": 10, "1e": [3, 27], "1e4": [17, 19, 25], "1e6": [14, 19], "1f4": 2, "1i": 49, "1l": 11, "1leiden": 10, "1log_total_fragment_count": 10, "1m": 10, "1mb": [2, 4], "1min": 15, "1nuc_signal_filt": 10, "1nucleosome_sign": 10, "1sampl": 10, "1site": 10, "1total_fragment_count": 10, "1tss_score": 10, "2": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "20": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 34, 36, 37, 38, 40, 42, 44, 45, 49, 50, 51], "200": [2, 3, 4, 8, 11, 13, 14, 15, 19, 25, 27, 28, 38, 41, 49], "2000": [7, 11, 13, 19, 21, 23, 32, 49, 51], "20000": [7, 13, 16, 27, 48], "200000": 28, "2000000": 11, "2000x100": 21, "2001": 49, "2002": [1, 50], "2003": 13, "20031921": 40, "2004": 15, "2005": [15, 21, 24], "2006": [2, 4, 21], "2007": [7, 15, 23, 24], "2008": [6, 15], "2009": 49, "200e": 40, "200px": 42, "201": [13, 24, 27, 28], "2010": [13, 14, 17, 24, 40, 49], "201004e": 14, "2011": [15, 21, 24, 50, 51], "2012": [7, 8, 17, 21, 24], "2013": [1, 2, 7, 15, 17, 23, 49], "2014": [1, 13, 14, 23, 24, 31, 49], "2015": [1, 7, 14, 15, 19, 22, 23, 24, 26, 49, 50], "2016": [1, 2, 5, 6, 7, 14, 15, 17, 21, 23, 24, 30, 48, 49, 50], "2017": [1, 3, 4, 7, 8, 13, 14, 15, 16, 17, 21, 22, 23, 24, 26, 30, 37, 47, 48, 49, 50], "20171": 34, "2018": [1, 2, 4, 5, 6, 7, 14, 15, 16, 19, 21, 23, 24, 25, 26, 41, 44, 47, 49, 50, 51], "20188746": [7, 14, 22], "2019": [1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 22, 23, 24, 25, 26, 31, 32, 38, 43, 44, 49, 50, 51], "202": [2, 13, 27, 28], "2020": [1, 2, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 28, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "20209620": 7, "2021": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "20210110": 1, "202105932": 48, "202110282": [50, 51], "202110798": 29, "2022": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 27, 28, 29, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "20220323_neurips21_bmmc_christoph": 10, "20220607": 2, "20220607t163052z": 2, "20220607t163055z": 2, "2023": [5, 9, 21, 25, 27, 30, 33, 39, 41, 44], "202427": 13, "2025": [4, 25, 50], "20267766": 40, "2027": 21, "20274924909862": 37, "203": [16, 19, 23, 27], "2031": 21, "203162": 41, "2032": 25, "204": 13, "20407": 17, "2049": 13, "205": [7, 13], "205217": 15, "206": [13, 48], "207": 27, "20729": 16, "2075": 28, "2076": 28, "208": [7, 13], "20801": 51, "209": [13, 48, 49], "2099": 47, "20antibodi": 4, "20bind": 4, "20px": 42, "20sequenc": 4, "21": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50, 51], "210": 13, "2100293118": 13, "21038": 14, "2105": 17, "2105859118": 51, "2105932": 48, "210719": 3, "211": 13, "211152": 17, "212": 24, "21246": 25, "213": [13, 27], "2135": 2, "21361": 11, "213795": 25, "214": 23, "215": [13, 27], "21583": 9, "216": 27, "2164": 17, "217": [13, 27], "217131": 14, "217223": 17, "21737": 48, "218": [2, 25, 49], "2184484": 48, "219": 49, "219184": 14, "21a": 25, "21b": 25, "21g": 49, "21m": 21, "22": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "220": [1, 39, 41, 49], "2202": 4, "220291": 10, "2207": 51, "221": 13, "2211": 5, "22155762": 40, "222": 27, "222037": 17, "2224": 13, "22256": 11, "223": [5, 27], "2234": 5, "224": [13, 14, 16, 26, 27, 44, 49], "2247": 5, "224m": 21, "225": 27, "225355": 3, "226": 28, "226039e": 7, "227": [25, 32, 33, 34, 48], "22714": 17, "228218e": 25, "22864": 13, "22906494140625": 37, "22969": 5, "22m": 21, "22mremov": 10, "23": [1, 2, 4, 5, 7, 8, 9, 13, 15, 17, 19, 21, 23, 24, 25, 27, 28, 39, 49], "230": 49, "23030": 6, "230531": 17, "230862e": 41, "230863": 25, "2310": 49, "2314": 49, "232": 27, "233": 27, "233993": 13, "234": 2, "234926e": 41, "235": [13, 17, 27], "235651": 17, "2356902356902357": 49, "2358": 14, "236": 27, "236452": 17, "236m": 2, "237": [24, 27], "2370": 4, "237082a0": 24, "237107": 17, "2372": 41, "23741063674291": 8, "2376": 41, "2378": 50, "237845": 17, "238": [7, 27], "239": [24, 27], "2392": 5, "239855e": 7, "23m": 21, "24": [1, 2, 4, 7, 8, 13, 14, 15, 17, 21, 24, 25, 26, 27, 28, 40, 48], "2402": 5, "240406e": 7, "241": [11, 15, 27], "24136": 27, "241950": 17, "241m": 21, "242": [1, 13, 27], "243": 27, "24326": 28, "243280": 17, "243787": 16, "243827": 38, "244": [15, 27, 49], "245": [13, 27, 48], "245327": 17, "24562": 14, "2462": 48, "246727": 17, "24673": [14, 15, 16], "247": [2, 17, 26, 27], "247085830": 2, "247920321": 7, "24807643": [47, 48], "2481": 14, "248421": 7, "24885": 4, "248959": 13, "249": [1, 7, 26, 27], "249159e": 14, "24it": [5, 19], "24m": 21, "25": [1, 2, 3, 6, 7, 8, 11, 13, 16, 17, 21, 24, 25, 27, 28, 38, 49], "250": [8, 15, 36, 37], "2500": [24, 36], "250160": 2, "251": 27, "25145999": 2, "2517": [13, 14], "251817e": 41, "252": 11, "2526": 21, "252930": 16, "253": [13, 24], "25352": 7, "2536": 11, "254": 4, "255": [13, 14], "255650623": 10, "2557408": 40, "25581122": 14, "2561": 17, "2562": 21, "257": [13, 27], "257408": 17, "2579": 41, "258": 27, "2584": 41, "258447": 47, "259": [1, 26], "25914": 2, "25957": 5, "25960": [14, 16], "2599": 14, "25k": [15, 25], "25m": 21, "25mb": 19, "26": [1, 2, 4, 7, 8, 13, 14, 16, 17, 19, 21, 23, 25, 27, 28, 40, 49], "260": 13, "261": 14, "2610": 49, "2617": 11, "2618": [13, 49], "2619": 4, "262": 1, "263": [7, 13], "26346801": 14, "264388": 17, "2644": 41, "2650": 41, "2651": 16, "265281": 25, "266": 24, "266164e": 14, "267": [13, 28], "267453": 25, "267814": 17, "26807": 17, "2685": 49, "268634": 47, "2688": [37, 41], "268886e": 15, "268972": 7, "2691": 17, "2692": 17, "269375": 7, "27": [1, 2, 4, 7, 8, 9, 10, 13, 14, 15, 21, 23, 25, 27, 36, 41, 49, 50], "270": 7, "2700": [19, 24], "270360": 41, "27085": 27, "271": [11, 38], "271008": 47, "2713": 49, "27150": 13, "271908": 23, "272": [27, 28], "2725": 11, "272807": 25, "273": 27, "2739": 5, "2742": 24, "275073": 17, "2755": 5, "2756": 11, "2757": 24, "276": [6, 13, 34], "27623436": 40, "276946": 17, "277122": 17, "2772": [23, 24], "27730927": 40, "27754053": 40, "277846": 15, "2778550400565002932400685513": 10, "278": [4, 14], "278267": 25, "2785": 26, "278576": 17, "27876": 50, "279": 13, "27998": 51, "27m": 21, "28": [1, 5, 7, 8, 9, 13, 14, 15, 16, 21, 25, 27, 28, 49, 50], "280": 40, "280023": 2, "280045": 2, "280e": 40, "281": [7, 13, 23, 50], "2810455o05rik": 41, "281529": 17, "2817": [13, 41], "281896": 17, "282": [11, 27, 28], "282002e": 15, "28213058": 40, "283": 13, "2836": 41, "284248": 17, "285": [7, 13], "285010": 7, "2858": 34, "286": 13, "28601": 21, "28692": 38, "287": 27, "2870": 47, "2874409": 48, "2878": 47, "288": 27, "289": 14, "28914454": 40, "289806": 14, "28it": 1, "28m": 21, "29": [1, 2, 7, 8, 9, 13, 15, 21, 23, 26, 27, 40, 47, 48], "290": 13, "29046": 36, "290e": 40, "291": 23, "291166": 3, "2916": 17, "292168": 13, "2924": 4, "292459e": 14, "2928460": 37, "2929": 4, "292929": 17, "293": [28, 49], "29356": 47, "294": 49, "2945": 4, "294886": 17, "295": [32, 49], "29505": 21, "2953": 15, "296": [13, 47], "2961": 15, "29645": 11, "296477site4donor8s4d810": 10, "296494": 13, "296701": 7, "297": [13, 50], "297617e": 15, "29768401": 40, "298131": 17, "29it": 4, "29m": 21, "2a05": 2, "2c": 23, "2d": [6, 7, 31, 36, 49, 51], "2d2": 23, "2e1": 49, "2e3bd02": 7, "2fgiac001": 23, "2fgigasci": 23, "2fj": 34, "2fs13059": [23, 48], "2fs41467": 14, "2g": 49, "2hg": [10, 11, 36], "2m": 4, "2nd": 15, "2x": 23, "3": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "30": [1, 2, 3, 4, 5, 6, 7, 8, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 32, 36, 37, 44, 49, 50], "300": [13, 14, 24], "3000": [11, 13, 24], "30000": 36, "300bp": 49, "300e": 40, "301": [23, 30, 34], "30169": 30, "3017": 14, "302": 2, "303": [13, 14], "3031588044": 49, "3033": 13, "303346e": 7, "3038": 11, "304042": 25, "304513": 13, "30472155": 40, "305": 13, "30508": 11, "30545": 51, "306": [13, 49], "307137e": 17, "30755": 25, "308": 25, "309": 4, "3092": 13, "3094": 23, "30992": [17, 26], "30m": 21, "31": [1, 2, 7, 8, 9, 13, 14, 15, 21, 23, 25, 27, 28, 33, 37, 40], "3100": 23, "311": 13, "311184": 36, "311677": 47, "311795e": 15, "312": [2, 28], "3120": 24, "31208": 5, "3125057": 40, "312797": 14, "313": 13, "313244": 13, "313440e": 17, "31369": 25, "314": 40, "3158": 14, "316": [23, 51], "3167": 37, "3168": 21, "317005": 11, "3175": 21, "318": 25, "3180": 17, "318167e": 7, "3192": 7, "31m": 21, "32": [1, 4, 7, 8, 13, 15, 16, 21, 23, 25, 27, 28], "3211": 13, "3212": 2, "321325e": 17, "322": [16, 23, 51], "3224": 25, "322763": 17, "32340": 27, "32401": 11, "3243": 14, "325": 10, "3251": 14, "3252": [19, 22], "325301": 17, "3255": 17, "32614": 14, "326969953": 10, "327": 50, "327003": 14, "32738": 19, "328": 4, "329": [13, 23], "32it": 1, "32m": 3, "33": [2, 4, 7, 8, 13, 15, 21, 27, 28, 30], "330": 40, "33088": 11, "331": [13, 16, 50], "33182": 41, "332": 16, "333": [13, 22], "333960": 13, "334": 4, "334078": 3, "33417": 17, "3349": 48, "3350": 4, "335187": 13, "33537": 27, "33541649": 40, "3356": [1, 2], "3358": [1, 13], "33604029": 14, "336171123": 10, "3367200": 2, "337": [14, 23], "338": [13, 48], "33856246": 38, "3389": [13, 23, 31], "339": [13, 22, 25, 48, 49], "3397624": 4, "33it": 4, "34": [2, 5, 6, 7, 8, 13, 15, 16, 21, 23, 25, 27, 28, 40, 47, 50], "340": [28, 48], "341": 16, "34106034": 40, "342": 13, "3420": 14, "342947": 13, "343": [41, 49], "343444": 17, "34369": 11, "344": 49, "34406673": 40, "3441": 4, "34464122": [15, 25], "345": 13, "34500357": 40, "3451": 21, "345130": 36, "345536": 14, "34560298": 19, "346": [17, 38, 41], "3464": 11, "34650092": 40, "34784232": 40, "348292e": 25, "348982": 13, "349": 4, "349605e": 15, "34e": 27, "34minfo": [5, 7, 16, 27, 28], "34p13": 19, "35": [1, 7, 8, 13, 14, 17, 23, 38, 40, 48, 49], "350": [8, 47], "3500": [1, 11], "350px": 42, "351": 28, "35136": 11, "3514": 13, "352": 49, "35233771": 15, "352e": 40, "353": 49, "35519": 14, "35574338": [2, 3], "35574539": 2, "355897": 3, "356": 25, "356206e": 7, "35636122": 40, "3566": 1, "357123": 13, "3573": [5, 27, 28], "3574": 1, "357973": 7, "358": 1, "3587": [5, 27, 28], "358946": 14, "359": 13, "359175783": 10, "35it": 25, "35m": 5, "36": [1, 2, 4, 8, 13, 14, 15, 16, 19, 21, 23, 24, 25, 28, 34, 36, 40, 49], "360": [13, 17], "3602": 11, "360854": 17, "360e": 40, "361": 49, "361088": 41, "362": 49, "362298e": 7, "362718": 41, "36357782": 40, "364": 25, "364741": 25, "365": 17, "36601": [10, 11, 34, 36, 44, 45, 46, 47, 48], "3665": 25, "367": [13, 16, 49, 50], "36741": [44, 45, 46, 47, 48], "367791": 13, "367997": 14, "368": 49, "369": 27, "3696": 51, "36970": 11, "36m10": 7, "37": [4, 7, 8, 13, 14, 15, 17, 23, 25, 27, 28, 37, 41, 50], "370": 24, "3709": 14, "371": [13, 49], "3711": [5, 6, 50], "372": 49, "37223306": 7, "3724_nt_t1": 49, "373": 13, "373613": 9, "373613v1": 9, "373670": 2, "374182": 25, "37445824": 40, "37460975": 40, "376": [5, 49], "376129": 15, "377": 13, "378": 14, "378736": 15, "37884": 11, "37998836": 36, "37it": 11, "37m": 21, "38": [2, 8, 13, 14, 15, 21, 24, 25, 28, 37, 49, 50, 51], "381": [24, 27], "382": 13, "38252823": 40, "3828": 14, "382e": 40, "383": 5, "3836": 16, "383709e": 41, "38390625": 37, "384": 21, "38442071": 40, "386294": 19, "386635": 7, "387": 24, "38725173": 40, "3873": 16, "388247": 14, "388413": 16, "3893": 11, "38m": 21, "39": [1, 2, 7, 8, 9, 13, 14, 15, 16, 17, 21, 23, 24, 25, 40, 44, 48, 49, 50, 51], "390": 17, "391": 13, "3914": 8, "392": [5, 7, 36], "393": 2, "3930": 7, "39347357": 36, "39347573": 36, "39360836": 38, "39360860": 38, "394": 13, "395": [4, 49], "39546196": [34, 48], "39546217": [34, 48], "3965a3": 42, "397": [2, 4, 8, 9, 15], "3971": 50, "3973": 48, "39758871": 40, "397878": 17, "399583": 16, "3998": 5, "39it": 3, "3_4": 7, "3col": 23, "3d": [31, 42, 49], "3k": [13, 19], "3m": 23, "3m2d4m": 23, "3rd": [7, 15], "4": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50], "40": [2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 19, 21, 24, 25, 27, 28, 36, 37, 38, 40, 49], "400": [7, 8, 9, 13, 14, 27, 28], "4000": [5, 7, 13, 15, 19, 27, 28, 32], "40000": 19, "40002": 28, "4000e": [27, 28], "40014331": 33, "40015741": 32, "40016014": 31, "400685513": 10, "400895": 13, "400e": 40, "400px": 42, "401": [27, 49], "401688e": 14, "4018683433533": 8, "402": [4, 11, 36], "402237": 17, "4025": 24, "402974": 25, "403": [9, 13], "403206": 47, "403485": 17, "403998": 13, "404": 13, "404424": 38, "405": 13, "405550": 25, "4056": 7, "406": 49, "4064": 4, "406509": 13, "406510": 16, "4068": 4, "40694372": 40, "4078": 1, "4081": 21, "40864": 38, "40871581": 40, "408890": 15, "409": 17, "4091": 7, "4096": 7, "4098": 13, "41": [3, 7, 8, 13, 25, 27, 28, 36], "410": 49, "410341e": 14, "410380e": 15, "410451e": 41, "411": [9, 21], "41213846": 40, "413005": 36, "4136": [27, 28], "413699": 7, "41376264": 5, "413772": 7, "414": 13, "41436645": 5, "41436648": 5, "41436666": 5, "41452287": 48, "41452308": 48, "41452434": [44, 45], "41452443": 46, "41452449": 47, "414776": 25, "415831e": 25, "416": 13, "41663": 36, "416844": 13, "4169": 16, "41695": [5, 6, 50], "418028": 14, "418293": 28, "4186": 27, "4187": 25, "419": [4, 50], "42": [2, 8, 13, 15, 17, 19, 21, 28, 40, 44], "420": 15, "420527": 28, "42056733": 40, "420668": 14, "42070949": 40, "42082271": 40, "421": [13, 44], "422": 7, "4220": [7, 24, 26, 27], "42242154": 17, "4227": 21, "423": [13, 50], "424174e": 14, "42494": 21, "425": [2, 49], "42569008": 48, "42569026": 48, "42569866": 43, "4258425": 40, "4259": 24, "4263": 25, "4265": 25, "427": [2, 49], "4272": 49, "4279": [7, 26], "427982e": 17, "4288": 49, "4292": 14, "429285": 14, "4295": 13, "43": [2, 4, 7, 8, 14, 15, 25, 27, 28, 40, 44, 49, 50], "430346": 41, "430966": 3, "431": 13, "432": [4, 13], "4325": [7, 26], "435": 21, "4354": 13, "436": 14, "436180": 13, "436426e": 17, "4380": [16, 47, 48, 50], "439": [13, 21], "44": [2, 4, 8, 11, 13, 21, 25, 27, 28, 44], "44002": 28, "4400e": 27, "440105": 13, "440e": 40, "4412": 25, "441362": 7, "441434": 3, "4421212": 40, "4427": 1, "443": [2, 13, 41, 49], "443255": 13, "44368289": 40, "4437": 7, "4443991184234619": 37, "44491": 3, "4450": 1, "446": 11, "446441": 17, "446902": 41, "447348": 17, "449": 13, "44m": 21, "45": [2, 7, 8, 13, 15, 16, 25, 27, 28, 40, 44, 50], "450": 8, "450e": 40, "451": [2, 11, 50], "452041e": 17, "45266": 2, "453": 13, "453021e": 41, "454": 24, "454514": 23, "45452260": 7, "454545": 13, "454901e": 7, "455069": 49, "456499": [19, 29], "45654": 3, "4566": 4, "457057": 28, "457491": 7, "457824": 25, "45918": 21, "46": [2, 3, 4, 7, 13, 15, 25, 27, 28, 44], "460": 50, "4612": 14, "461982": 49, "462134": 41, "46317761": 40, "4636": 41, "466": [4, 11], "466045": 41, "4665090": 37, "466587": 25, "467": 24, "467676": 13, "46780626": 40, "46793569": 40, "468": 25, "468194": 14, "468524": 14, "469": 49, "46it": 4, "46tf": 8, "47": [2, 8, 9, 13, 15, 25, 38, 44], "4700539": 40, "4710": 17, "4720": 1, "4721": 1, "473": 49, "473007": 19, "4732440d04rik": 41, "4734": 1, "4735": 1, "4736": 1, "4737": 1, "4741": 1, "474933": 50, "475": 13, "475259": 15, "476224": 8, "4764": 11, "476694e": 41, "476942": 7, "4772": 50, "4776": 41, "47760796546936035": 37, "477612": 13, "478": 7, "478744": 13, "478789e": 41, "478816": 25, "479": [16, 24], "479209": 25, "4795056255239651957255650623": 10, "479982": 25, "47e": 28, "47m": 21, "48": [1, 13, 16, 21, 26, 27, 38, 44], "480": 13, "4804": 48, "480662": 14, "481": 23, "481684": 27, "4817": [2, 19], "4818": [2, 19], "481913": 7, "483747": [7, 50], "485": 2, "48550": [5, 50, 51], "485521": 7, "48577": 21, "486": 50, "486142": 25, "487": 23, "487975": 7, "488585": 7, "488960": 9, "488960v1": 9, "489449": 23, "4895": [7, 26], "489989": [47, 48], "49": [7, 8, 10, 13, 15, 17, 25, 27, 28, 36, 44, 50], "490": 50, "490241": 5, "490536": [9, 28], "490536v1": 9, "490m": 21, "491": 23, "491204": 13, "49172687": 40, "492": [13, 48], "492298e": 41, "493646": 14, "494": [50, 51], "494025": 7, "494067": 25, "494717": 51, "494849": 40, "495": 7, "496": [2, 13, 23], "497166": 28, "4975": 28, "498": [50, 51], "498070": 17, "499": [2, 3, 23, 24, 48], "499381": 51, "49d": 49, "49i": 49, "49m": 21, "49mb": 49, "4m": 50, "4mb": 2, "4th": [15, 49], "5": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 51], "50": [1, 2, 3, 5, 8, 9, 11, 13, 15, 16, 17, 19, 21, 26, 27, 28, 31, 36, 37, 38, 40, 44, 45, 49, 50], "500": [5, 15, 19, 25, 26, 28, 32, 37, 38], "5000": [8, 17, 24], "5001": 8, "50081508": 40, "500e": 40, "501": 44, "501761": 25, "502": [7, 23], "503709": 51, "504": [13, 49], "50406265258789": 37, "504975e": 15, "504x504": 49, "505241": 50, "505243": 50, "506": 21, "507": 16, "507059": 25, "5076": 16, "508343e": 17, "5085": 16, "5088": 4, "5090": 21, "509375": 37, "5095": 17, "50it": 4, "50m": 21, "51": [1, 2, 8, 13, 15, 16, 27, 28, 44], "510": 44, "5102": 17, "5105": 4, "510513": 16, "511184": 17, "511733": 25, "511785": 3, "511875e": 15, "5119975805282593": 37, "512": [2, 13], "5122": 2, "512274": 41, "512525": 36, "512619": 16, "513303": 36, "513436": 28, "514": 13, "5150": 1, "517": [13, 36], "517788e": 15, "519": 37, "5191": 41, "519376": 13, "519725": 25, "51it": 36, "52": [1, 2, 13, 15, 25, 27, 28, 43, 44], "520368": 7, "5209": 4, "521329site4donor8s4d84": 10, "521436": 21, "5219": [27, 28], "522": 16, "52229328": 40, "523": 50, "5233": [5, 6], "524": [13, 24, 47], "525": 23, "526": [13, 36], "526175": 16, "526785": 7, "526812": 13, "527": 23, "527143": 16, "5281": [2, 3], "529": [16, 51], "52983503": 40, "52e": 16, "52it": 1, "53": [1, 5, 7, 8, 9, 11, 13, 15, 16, 27, 28], "530": 49, "531540": 15, "532": 13, "53203586": 40, "5325": 4, "5326": 21, "53420802": 40, "53496568": 40, "535": 48, "5350": 24, "535313e": 15, "535377e": 17, "53570662": 40, "535749e": 14, "535838": 15, "5362": 17, "537": 16, "537850": 7, "5387": 4, "539": 13, "53it": 1, "54": [1, 2, 3, 7, 11, 13, 15, 25, 27, 49], "540": 25, "540272": 16, "541": 49, "5416": 31, "541763": 25, "54187862": 40, "542": 27, "5421812": 25, "543": 49, "5430": 4, "544": 40, "54457": 3, "54475788": 40, "5458": 13, "546": [7, 27], "5468": 6, "547": [3, 4, 13, 25], "547428": 13, "547630": 2, "548": [13, 27], "5488": 41, "549083": 21, "54d": 49, "54it": 13, "55": [2, 4, 5, 8, 13, 15, 25, 27, 28, 37, 40, 44, 48], "550": [14, 48], "55077944": 40, "551": [13, 22], "552114": 16, "5527279": 9, "553": 1, "553531": 41, "553709": 13, "554": 1, "5550": 49, "555215": 10, "5552150": 10, "555236e": 15, "555469": 7, "555549": 25, "555775": 7, "556": [17, 49], "5560": 16, "556232": 7, "556985e": 41, "5575": 4, "557630": 16, "55767703": 40, "5581": 27, "558166": 13, "559": [7, 13], "559358e": 7, "55it": 36, "55mu": 36, "55um": 39, "56": [1, 5, 7, 13, 15, 21, 25, 31, 32, 33, 34, 40, 43, 44, 45, 46, 47, 48, 49, 50], "560": [23, 50, 51], "560000": 16, "5603": 41, "560875": 7, "561": 13, "561817e": 15, "562": 14, "562213": 25, "563": [2, 24], "564": [2, 13, 49], "564695": 16, "5647": 7, "565": [2, 14, 36], "565189": 3, "565442": 3, "566": [2, 13, 23, 49], "566315": 28, "566431": 13, "566888": 28, "5678": [13, 16], "5683": 4, "569": 7, "56904737": 40, "5692": [14, 16], "5696": 14, "5697": 16, "57": [1, 4, 8, 11, 14, 15, 21, 34, 40, 44], "570": 49, "5703": 41, "570953": 7, "571": [13, 14, 17, 50], "571231": 7, "571484375": 37, "571902e": 17, "572272": 14, "573": [2, 13], "573147": 47, "573561": 38, "574": 2, "57481": 43, "575": 49, "575714": 16, "576": 13, "578": [13, 14, 17, 49], "5780": 50, "578837907": 37, "579": [2, 17], "58": [4, 7, 8, 13, 21, 23, 25, 27, 28, 44], "580": 13, "580000": 16, "580189": 21, "580645": 49, "58097471": 40, "581": 47, "581210": 21, "581859": 3, "5828295": 40, "582m": 21, "583756": 21, "584": [7, 49], "5843360424041748": 37, "5847462": 49, "586": 13, "587": 7, "587059": 16, "587789": 16, "587934": 7, "587953": 15, "588481": 16, "588583": 14, "589": 13, "5890": 5, "5893556": 4, "58m": 19, "59": [1, 2, 6, 8, 15, 21, 25, 27, 50], "590": 7, "591230": 16, "591423": 13, "592619": 16, "592979": 25, "593": 13, "59374816": 40, "594": 21, "595822": 28, "596": 13, "596787": 14, "597": 13, "597106e": 14, "598": [13, 27, 50], "598050": 16, "598994": 13, "599": [21, 49], "5991668": 40, "59e": 36, "5d": 49, "5k": [36, 49], "5tukhkyz8kfr0000": 50, "6": [1, 2, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 21, 22, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 42, 44, 49, 50, 51], "60": [2, 4, 7, 8, 13, 21, 25, 27, 37], "600": [3, 13, 21, 25, 26], "6000": 7, "600434e": 7, "60055": 4, "600587": 13, "600777site4donor8s4d83": 10, "601": [4, 13, 34], "601172": 16, "601183": 14, "601672e": 41, "602": 21, "60339076": 40, "603415": 26, "604": [5, 43], "604138": 25, "6041789": 40, "604396": 21, "6047": 5, "605": 21, "607": 25, "608": [36, 49, 50], "608087e": 7, "609": 21, "609438": 19, "61": [8, 15, 16, 21, 25, 27, 28, 40], "610": [17, 21], "6100": 28, "610330": 16, "6111": [7, 26, 27], "611682": 3, "6127": 49, "613": [8, 21], "613233": 7, "614": 13, "614335": 4, "614805": 21, "61496228": 7, "615": 13, "6161": [13, 14], "61634144": 40, "616984": 16, "617": 13, "617856": 25, "618": [13, 21], "6181": 4, "619": 13, "6190": [4, 49], "6191": 4, "62": [1, 2, 7, 37, 51], "62002": 21, "62040415": 40, "62114": 21, "622": 21, "6224": [7, 8, 26], "622425": 8, "622430": 8, "622540": 16, "62254826": 40, "622731": 25, "623923": 16, "624": 4, "624770": 15, "624898": 16, "625": 13, "625245": 4, "625692": 16, "626": [2, 8], "626247": 16, "627": 13, "6278": 17, "6282": 49, "628266": 15, "628780e": 14, "629": 13, "629516": 4, "6298": 49, "62it": [1, 4], "62m": 21, "63": [2, 3, 8, 13, 15, 25, 27, 28, 40], "630593": 16, "63068773": 40, "63097371": 40, "631": 24, "632": [17, 27], "633906": 16, "634": [13, 27], "634978": 13, "635": [2, 27], "635792": 4, "636": [13, 27], "6366": 1, "637": [2, 13, 31], "6379": 21, "63m": 21, "64": [1, 7, 8, 13, 15, 23, 25, 27, 28, 40, 49], "640": 31, "640373": 14, "6405": 49, "641": 27, "641251e": 17, "6413": 49, "6417569358653972565359175783": 10, "6424": 49, "642700": 16, "643": [24, 27], "644": 2, "644404": 25, "64480": 21, "645": 13, "6453755": 43, "645837": 7, "646": 2, "64661": 3, "646936": 31, "647": 27, "6473": 16, "6479": 49, "648": 7, "6482": 50, "6483": 48, "649724": 13, "64bit": [7, 15, 21], "64e": 28, "65": [2, 7, 8, 15, 24, 37], "651": 13, "651011e": 15, "652": 13, "653": [5, 14], "653187e": 7, "6532": 49, "6535": 49, "6538": 49, "654": 13, "654201": 14, "6542056ns_pass": 10, "656202": 16, "656979e": 14, "657050": 14, "658": [13, 49], "6586": 41, "6587": 41, "658766": 25, "6588": 41, "6589": 41, "659": [27, 44], "6590": 41, "65903": 21, "6590886": 40, "6591": 41, "65912586": 40, "6592": 41, "6593": 41, "6594": [5, 41], "65e": 28, "66": [2, 8, 13, 25], "660366": 23, "661": 36, "661643e": 7, "662": [14, 27, 36, 38], "662003": 3, "663": [13, 15, 36], "664": 49, "6643357ns_pass": 10, "66527343749999": 37, "666": 11, "667": [4, 27], "668": 27, "668338": 7, "668948": 28, "669": 27, "669376": 16, "669951": 14, "66it": 4, "67": [7, 8, 11, 13, 15, 25, 27, 28, 40], "670": [36, 38], "670147e": 14, "670412": 13, "671": [27, 36], "6722": 4, "672811": 49, "673": [4, 5], "673299": 16, "673419": 41, "673512": 41, "673902": 4, "674": [8, 27], "6740": [7, 26], "674505": 16, "674579": 13, "674640": 14, "675": 7, "67513": 23, "676": 27, "676061e": 17, "676270": 7, "677": 27, "677266": 14, "678": 40, "6781": [7, 26], "6789298ns_pass12": 10, "68": [27, 41, 49], "680173": 43, "681": 13, "681318287535559": 3, "682": 44, "6828": 1, "683484": 26, "684": 13, "684446": 41, "684545": 41, "6848676": 40, "685439": 4, "6876": 13, "6879": 21, "688720703125": 37, "689176site4donor8s4d86": 10, "689503e": 14, "68m": 21, "69": [7, 8, 26, 27], "690": 49, "690300": 13, "690730": 25, "691": 47, "69249": [7, 26, 27, 28], "692666": 48, "693147": 19, "693653": 13, "694572": 38, "696119": 13, "696759": 14, "697710": 7, "6982": 2, "699": [13, 23], "69d": 2, "6a10": 2, "6h": [14, 16], "6th": 49, "7": [1, 2, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "70": [2, 4, 8, 13, 15, 24, 25, 27, 28, 33, 37, 40, 48, 49], "700": [24, 30, 49], "700e": 40, "701555": 15, "702486": 14, "703": [14, 27], "703306": 13, "703607": 15, "704322": 10, "7043220": 10, "704363": 7, "706": [17, 23, 47], "707": 13, "7074291": 25, "709": [13, 27], "709340": 7, "709836": 14, "71": [1, 8, 25, 40], "710": 27, "710743e": 15, "71087": 21, "710956": 14, "711": 14, "711311e": 7, "712": 13, "71216796875": 37, "712952": 13, "713": [13, 14], "714": [4, 49], "715": [7, 16, 17], "716": 13, "716018": 7, "716935": 7, "718": 49, "718796": 21, "71b2": 2, "71it": 49, "72": [2, 13, 24, 27, 40], "720537": 13, "720e": 40, "721": [7, 13, 16], "721757": 7, "721817": 15, "72449982": 40, "7246": 11, "7247": 9, "7261": 9, "727155": 13, "727261": 28, "728": [3, 9, 13], "7285": 24, "729": 13, "7290": 24, "729036": 28, "72e": 13, "72it": 11, "73": [8, 13, 24, 25, 27, 28], "730": 25, "730018e": 14, "732": 7, "73202": 48, "732079": 15, "732197": 26, "733": [13, 50], "734": 4, "735": [4, 13, 14], "735108": 13, "735157": 16, "736": [2, 13, 25, 40], "736910": 28, "737": 24, "738": 14, "738471": 7, "739": [13, 49], "74": [13, 24, 40], "740": [9, 50], "741": 39, "741429e": 14, "742": 13, "7421": 2, "742801": 16, "743": 14, "7433689832687378": 37, "743605": 16, "743707": 16, "744": [2, 13], "744249": 16, "744932": 48, "745": 49, "746": [13, 24], "746709": 13, "747": [7, 24, 49], "7473": 2, "748": 2, "749": 13, "75": [4, 8, 11, 13, 15, 24], "750": [2, 11], "750583": 26, "751": 3, "751305": 14, "753": 25, "753417": 7, "755": 24, "756032": 16, "7561": 50, "7570b3": 7, "759": [13, 39], "7590625": 37, "76": [2, 8, 13, 25, 27, 28, 49], "760814": 41, "7612": 41, "762": 25, "76287001": 40, "763": 47, "76328672": 40, "763377": 25, "7635": 49, "7647": 49, "764977": 49, "765210e": 15, "766": [25, 36], "7661": [3, 4], "766405": 13, "766446e": 14, "7665505ns_pass": 10, "766927e": 14, "767": 25, "7680": [13, 22], "768099": 41, "769": 13, "769116": 16, "769131": 13, "7699": 49, "77": [2, 8, 13, 27, 49], "771": 27, "7719": [50, 51], "772": [13, 49], "7729": 24, "773": 17, "773420": 14, "7735": 49, "7744": 2, "7745": 23, "774925": 13, "775289": 7, "7759": 49, "776": 25, "7761": 4, "7765": 50, "777": [27, 36], "777093": 48, "778762": 13, "779": [13, 27], "7793": 49, "779699": 16, "78": [13, 24, 27, 37, 40], "780330": 16, "780933": 16, "780e": 40, "781": [25, 27], "78180094": 40, "782": [17, 27], "782599": 28, "782879": 41, "783628": 16, "784": 13, "7841": 48, "786": [13, 27, 28], "786726": 7, "786800": 16, "787": [27, 28], "787177": 13, "787879": 13, "7880": 50, "788894": 7, "78it": 4, "79": [1, 2, 8, 13, 16, 25, 27, 28, 37], "7904": 5, "791": 4, "791759": 19, "7919": 25, "7921": 49, "7924": [36, 50], "792996": 16, "793133": 14, "7937": 2, "795": 3, "79518632": 40, "795791": 48, "796": 49, "796760": 28, "797": [13, 44], "798": 27, "79949063": 40, "7fjo": 4, "7m": 49, "7te1": 4, "8": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 44, 47, 48, 49, 50, 51], "80": [4, 6, 15, 17, 19, 24, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "800": [16, 24], "8000": 24, "800875": 28, "800e": 40, "801": 25, "801417": 16, "801776e": 15, "80187795": 40, "8023": [7, 26], "803": 13, "804": 13, "804169": 47, "80491293": 7, "805": 13, "805382": 13, "806": [2, 13], "806636": 16, "806682e": 17, "806917": 7, "807": 13, "808": 13, "808672": 28, "808744": 25, "809135": 48, "80it": 4, "80m": 21, "81": [8, 23], "810": [13, 49], "811296": 13, "813": [23, 51], "814": 27, "81470655": 40, "815": [2, 27], "816508": 16, "817": 13, "817033": 16, "81758862": 40, "81768536": 40, "818": [23, 27, 51], "818029e": 25, "81m": 2, "82": [24, 25, 27, 28, 49], "822": 2, "824": [7, 27], "82483187": 40, "824921e": 14, "825716": 13, "826": 49, "826349": 16, "828": [1, 27], "828314": 48, "828461": 41, "829": 27, "829060e": 17, "83": [4, 8, 40], "830": 2, "830160e": 41, "830189": 13, "830964e": 7, "831": [25, 27], "831962": 15, "833": 27, "833656": 7, "835": [4, 27], "835072": 16, "835278": 26, "835813e": 25, "836": 25, "836198e": 15, "83673": 21, "837373e": 14, "83739543": 40, "839": 13, "83917564": 40, "83928709": 40, "8394": 21, "83it": [4, 13], "84": [2, 15, 25, 40], "840": 4, "840017e": 25, "841986": 41, "842": 13, "842074": 41, "842316": 7, "843872e": 25, "844158": 15, "84451806": 2, "844788": 10, "8447880": 10, "845": [27, 50], "845827": 3, "846": 1, "847007": 16, "847296e": 15, "847325": 28, "847772": 7, "848": 50, "849110": 41, "85": [8, 13, 15, 25, 27, 28], "850": [4, 14], "851": 13, "851652e": 41, "851992": 10, "8519920": 10, "852": [1, 7], "8520": 25, "8534": 25, "854350": 36, "854867": 28, "857": 13, "858930": 25, "859110": 7, "859812": 48, "85984283": 40, "86": [17, 36], "8600": 21, "861761": 41, "862": 27, "862745": 13, "86332": 5, "864": 38, "865": [16, 47, 48, 50], "866542": 41, "8674": [17, 26], "868": [13, 16, 47, 48, 50], "86826297": 40, "86853162": 40, "868723": 41, "869": 34, "86it": [4, 36], "87": [4, 8, 15, 27, 40], "87010332": 40, "871410e": 7, "872": [13, 40], "874753": 41, "875000": 13, "87520289": 40, "876": 13, "876626": 13, "877": 14, "877078": 14, "877567": 25, "878": 40, "8783461218238": 25, "8783489520283": 25, "8783502753003": 25, "87860": 17, "879": 13, "879454": 7, "879555": 10, "8795551": 10, "879631": 13, "87it": 4, "88": [7, 24, 25, 27, 28], "880493": 13, "88126696": 40, "882": 10, "886244": 13, "886662": 28, "887735": 7, "888": 21, "888212e": 15, "888747": 41, "888934": 16, "888983": 48, "88912876": 40, "889446": 7, "89": [3, 4, 6, 8, 14, 15, 16, 25], "89059": 21, "890983site4donor8s4d83": 10, "891": 44, "8910": 21, "89201807975769": 8, "892693": 43, "893431": 15, "894241": 15, "894277site4donor8s4d80": 10, "8946": 21, "89471": 15, "89472": 15, "89473": 15, "89474": 15, "89475": 15, "89476": 15, "89478485": 37, "897": [4, 13], "897245": 14, "89883": 17, "89m": 21, "8b": 24, "9": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "90": [1, 5, 8, 14, 23, 40, 49], "900": 24, "9000": 21, "9001": 27, "900e": 40, "901060": 7, "902": 40, "90261": [27, 28], "902793e": 17, "903": 4, "904": [1, 2, 13], "904970": 16, "905402": 7, "906": 41, "907": 13, "907165": 7, "908": 14, "908718": 13, "9088": 17, "9089": 17, "909": 13, "90907953": 40, "9091": 17, "9092": 17, "9093": 17, "9094": 17, "9095": 17, "9096": 17, "9097": 17, "9098": 17, "9099": 17, "90th": 23, "91": [8, 13, 15, 25, 26, 27, 28], "910": 13, "9100": 17, "910013e": 41, "9101": 17, "9102": 17, "9103": 17, "9104": 17, "9105": 17, "9106": 17, "910679": 28, "9107": 17, "9108": 17, "910886e": 7, "9109": 17, "911": 38, "9110": 17, "9112": 17, "9113": 17, "9114": 17, "9116": 17, "9117": 17, "9118": 17, "9119": 17, "912": 13, "9120": [17, 21], "9121": 17, "9122": 17, "9123": 17, "9124": 17, "9125": 17, "9126": 17, "9127": 17, "9128": 17, "9129": 17, "913": 13, "9130": 17, "9131": 17, "913474": 7, "914140": 28, "915237": 7, "916": [1, 2, 49], "916060": 13, "9165": 17, "9166": 17, "9167": 17, "9168": 17, "9169": 17, "9170": 17, "9171": 17, "9172": 17, "917264": 26, "918": 47, "918486": 38, "919285": 7, "9198482": 40, "92": [3, 4, 7, 40], "920183e": 14, "920476": 16, "921": 7, "921133": 14, "9223": 28, "924": 13, "924885": 14, "925": 13, "926409": 13, "927": [4, 27], "92787693": 40, "928": [14, 49], "9284": 3, "928962e": 41, "92952": 21, "929809": 38, "92m": [21, 50], "93": [3, 4, 8, 25, 37], "930": 13, "931": 38, "931002": 13, "931371": 38, "931475": 7, "932": [13, 49], "932017": 10, "9320170": 10, "933080": 13, "934": [13, 27, 34], "935": [7, 13], "935320e": 25, "935677e": 7, "936": [7, 27, 48], "93674686223055": 37, "937": [27, 38], "9370": 5, "938": 27, "938353": 13, "938400": 38, "939": [44, 48], "94": [1, 3, 4, 7, 14, 15, 16, 25, 27, 28, 49], "940": [13, 39], "941": 38, "941194": 7, "941976": 13, "942": [13, 27], "942619": 41, "943": [21, 27, 49], "943484": 14, "943768": 14, "9448": 38, "945946": 13, "9468": 4, "94699794": 40, "947": 27, "94739732": 40, "948": [13, 27], "948760": 48, "94m": 50, "95": [8, 14, 23, 27, 36, 37], "9504644ns_pass": 10, "950519": 41, "951949": 13, "952": [21, 27], "952170": 14, "9525": 30, "953": 44, "954": [13, 21], "955": 39, "957": 13, "958": 21, "95861812": 40, "959142": 21, "959439": 28, "95e": 36, "95it": 4, "95mmodel": 5, "96": [7, 13, 14, 37, 51], "960": 2, "961": 5, "964611": 15, "965": 21, "965786e": 25, "966242": 38, "966629": 14, "966640e": 15, "967249": 48, "967723": 11, "968": 13, "969": [5, 21], "969514": 7, "96it": 4, "97": [4, 5, 8, 13, 25, 27, 28, 37], "970": [13, 47], "970597": 7, "971": 13, "972292e": 7, "974": 16, "975": 8, "975838": 25, "976": [13, 21], "9763": 11, "976548": 25, "97723212": 40, "977985": 38, "978": 8, "9781420072877": 40, "979729": 41, "98": [3, 4, 5, 7, 8, 15, 21, 23, 27, 28, 49], "980": 15, "980689": 25, "981": 17, "981884": 13, "982": [21, 27], "982125": 25, "982928": 13, "982935": 25, "982940": 7, "983": [5, 17, 27], "983729": 7, "984": 13, "9842": 13, "9842x847": 13, "984389": 14, "984937": 14, "985": 13, "9852": 13, "985533": 7, "986": 5, "986854": 13, "986995": 43, "987": [8, 15], "9875": 1, "9876": [7, 26], "9880": 1, "988357": 38, "989": 27, "989366": 7, "99": [3, 8, 11, 36, 49], "9900": 21, "991": [13, 50], "991655e": 15, "992": 36, "992065": 41, "992305": 41, "992308": 41, "993": 27, "99305736": 40, "9931": 7, "994": 13, "994851": 11, "995": [11, 27], "997": 27, "9986": 17, "999": 36, "99900": 21, "9996": 13, "99976227": 8, "99982818": 1, "9999": 47, "99th": 5, "9b89970eac2a3bd770e744f63c7763419486b14c": 21, "9min": 14, "A": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 43, 45, 47, 48, 49, 50, 51], "And": [2, 5, 13, 14, 28], "As": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 34, 36, 37, 38, 39, 41, 43, 44, 45, 46, 48, 49, 50, 51], "At": [8, 13, 19, 23, 24, 26, 47, 49], "Be": [13, 15, 30], "Being": 38, "But": [0, 13, 32, 34], "By": [1, 3, 4, 7, 11, 13, 15, 16, 17, 19, 21, 25, 28, 30, 36, 39, 40, 48, 49], "For": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 33, 34, 36, 37, 38, 40, 41, 43, 44, 48, 49, 50, 51], "If": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 37, 47, 48, 49, 51], "In": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "Ines": [23, 24], "It": [0, 1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 28, 30, 31, 33, 34, 36, 41, 43, 44, 46, 49], "Its": [22, 24], "Near": 23, "No": [1, 4, 5, 7, 10, 15, 21, 23, 25, 27, 28, 36], "Not": [1, 4, 7, 31], "OFS": 23, "ONE": 24, "Of": [13, 19, 23, 36, 49], "On": [1, 3, 4, 7, 9, 14, 21, 23, 24, 25, 28, 40, 41, 48, 49, 50, 51], "One": [1, 2, 5, 7, 8, 11, 13, 16, 23, 26, 28, 36, 37, 40, 41, 48, 49, 50], "Or": [5, 25], "Such": [3, 4, 5, 15, 23, 24, 49], "That": [1, 14, 34, 49], "The": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 29, 30, 31, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50], "Their": [4, 34, 36], "Then": [8, 13, 23, 25], "There": [1, 2, 4, 5, 7, 11, 13, 15, 16, 23, 24, 27, 33, 47, 48, 49], "These": [2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 27, 30, 31, 33, 34, 36, 38, 39, 48, 49, 50, 51], "To": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 34, 36, 37, 38, 39, 40, 43, 48, 49, 50, 51], "Will": [4, 11], "With": [3, 4, 5, 9, 10, 11, 19, 23, 24, 29, 46, 48, 49], "_": [1, 2, 3, 10, 14, 15, 19, 21, 25, 27, 28, 36, 38, 41, 49], "__": 28, "____": 28, "______": 28, "__categori": 7, "__class__": 21, "__future__": 15, "_aa": 2, "_adt_cit": 27, "_align": 4, "_atac": 11, "_atac_multiom": 27, "_b": 42, "_call": 2, "_color": 7, "_complex": 25, "_core": [4, 11, 19, 21, 34], "_epoch_end": 28, "_eprint": [6, 36], "_file": 38, "_fullir": 4, "_g": 36, "_gene": 2, "_get_obs_rep": 15, "_ham": 4, "_highly_variable_gen": 7, "_index": 7, "_indic": 36, "_io": 7, "_junction": 2, "_locu": 2, "_mean": 25, "_minpack_pi": 41, "_network": 1, "_node": 13, "_nt": 2, "_overloaded_dict": 1, "_product": 2, "_prop": 25, "_prot": 27, "_r1_": 23, "_r2_": 23, "_remote_module_non_script": 5, "_rna": 27, "_rna_cit": 27, "_rna_multiom": 27, "_scvi": 7, "_scvi_batch": [7, 27, 36], "_scvi_extra_categorical_cov": [27, 36], "_scvi_label": [7, 27, 36], "_scvi_manager_uuid": [7, 27, 36], "_scvi_uuid": [7, 27, 36], "_static": 1, "_supplement": 38, "_t": 36, "_tool": [7, 25, 36], "_un": 1, "_validate_cell_df": 4, "_vj": 4, "a8d480": 42, "a_g": 36, "aa": [1, 4], "aaaaaa": 49, "aaaaaacatgt": 49, "aaaaaacgata": 49, "aaaat": 49, "aaaatgatat": 49, "aaacagccaagcttat": [10, 11], "aaacagccatagcttg": 11, "aaacagccatgaaatg": [10, 11], "aaacagccatgtttgg": [10, 11], "aaacatacatttcc": 14, "aaacataccacaac": 13, "aaacataccagaaa": 14, "aaacataccatgca": 14, "aaacatacctcgct": 14, "aaacatacctggta": 14, "aaacatgcaacgtgct": [10, 11], "aaacatgcaatatagg": [10, 11], "aaacatgcaattaacc": 10, "aaacccaaggatggct": [27, 28, 48], "aaacccaaggcctaga": [27, 28, 48], "aaacccaagtgagtgc": [27, 28, 48], "aaacccacaagaggct": [27, 28, 48], "aaacccacatcgtggc": [27, 28, 48], "aaacccacattctcta": [27, 28], "aaacccagtccgcagt": [27, 28], "aaacccagtgcatact": [27, 28], "aaacccagttgacgga": [27, 28], "aaacccatcgatactg": [27, 28], "aaacctgagaaaccta": 2, "aaacctgagaacaatc": 2, "aaacctgagaactcgg": 2, "aaacctgagaagccca": 2, "aaacctgagaaggaca": 2, "aaacctgagaataggg": 2, "aaacctgagaatgtgt": 2, "aaacctgagacactaa": 2, "aaacctgagcgatata": 2, "aaacctgtctaccaga": 2, "aaacgcacgaggac": 13, "aaacgcactagcca": 13, "aaacgcactgtccc": 13, "aaacgggcatttgctt": 2, "aaacggggtagcacga": 2, "aaacgggtcgtaccgg": 2, "aaacttgaccacct": 13, "aaagcaagtcgaaagc": 2, "aaatg": 49, "aaatggatat": 49, "aab": 28, "aacaaaggttggtact": 28, "aacgttgagctgcgaa": 2, "aactcagtcaaagtag": 2, "aactcccaggtgcaca": 2, "aactccccaagtacct": 2, "aactcttagcaccgct": 3, "aactcttcagatcgga": 2, "aactggtcagggagag": 2, "aadel": 17, "aaed1": 14, "aaf7907": 49, "aamodt": 25, "aar5780": 50, "aaron": [5, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 27, 28, 34, 48, 49, 51], "aattc": 49, "aax3072": 50, "ab": [4, 5, 6, 8, 13, 14, 15, 17, 22, 24, 29, 38, 50, 51], "aba2619": 17, "abadi": 50, "abb": 4, "abba": 23, "abbrevi": 19, "abc": 42, "abcb4": 38, "abd": 51, "abdab": 4, "abdab_200422": 4, "abdela": [5, 38], "abel": 49, "abf1356": 25, "abha": 23, "abhijeet": 9, "abi": 24, "abi1": 14, "abigail": 9, "abil": [21, 24, 38], "abind": [7, 21], "abind_1": [25, 27, 28], "abl": [0, 1, 2, 4, 5, 7, 8, 13, 14, 15, 16, 24, 25, 28, 33, 48, 50], "abl5197": 5, "abm": 25, "abnorm": [2, 24], "about": [1, 2, 3, 4, 5, 7, 8, 11, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 38, 49, 50], "abov": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 36, 40, 45, 46, 48, 49, 50, 51], "abq3745": 51, "abracl": 14, "absenc": [17, 25], "absl": 7, "absolut": [2, 7, 8, 11, 13, 14, 15, 17, 24, 34, 42], "absorb": 50, "abstract": [6, 23, 41, 49, 50], "abstractli": 6, "abund": [3, 4, 7, 14, 15, 16, 17, 23, 24, 25, 27, 28, 36, 43, 47, 48, 51], "abyzov": 49, "ac": [3, 4, 5, 11, 19], "ac002321": 19, "ac145205": 19, "ac213203": 11, "ac240274": 7, "acaccaagtcgattgt": 2, "academ": [2, 4, 9, 14, 17, 19, 25, 26, 36, 38], "academi": [1, 4, 13, 15, 24, 51], "acadvl": 14, "acaggtgctcaaatr1": 49, "acaggtgctcaaatr2": 49, "acaggtgctcaaatr3": 49, "acatcagcatactacg": 2, "acc": 13, "acc_scor": 8, "accept": [5, 7, 13, 21, 23], "access": [0, 2, 4, 5, 7, 9, 11, 16, 18, 22, 24, 26, 28, 30, 36, 38, 39, 41, 48, 49, 50], "accessor": 19, "accommod": 15, "accomod": 15, "accompani": [9, 16, 22, 29, 49], "accomplish": [24, 37], "accord": [1, 8, 11, 14, 15, 16, 18, 23, 24, 25, 26, 32, 34, 36, 38, 40, 49, 50], "accordingli": [3, 4], "account": [1, 4, 5, 6, 7, 9, 13, 14, 15, 16, 18, 19, 23, 28, 33, 36, 37, 41, 49, 50, 51], "acctgtcaggactggt": [27, 28], "accumul": [2, 49], "accur": [1, 2, 3, 4, 5, 7, 13, 14, 15, 17, 18, 23, 24, 25, 26, 30, 36, 37, 44, 49, 50, 51], "accuraci": [4, 5, 15, 16, 17, 18, 23, 24, 25, 31, 34, 36, 38, 49], "acetyl": 9, "acgcc": 49, "acgtaacaggtctact": 27, "achiev": [0, 2, 7, 15, 23, 24, 34, 36, 38, 50, 51], "achil": [7, 38], "achillesencod": 3, "acid": [1, 2, 3, 4, 7, 9, 14, 15, 18, 24, 25, 26, 36, 38, 49], "acjn21": 25, "acknowledg": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 49, 50], "acm": 50, "acot9": 14, "acquir": [1, 18, 24, 30, 49], "acr": 50, "acronym": 18, "across": [1, 3, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 38, 41, 47, 48, 49, 51], "acsm3": [5, 12], "act": [18, 21, 24, 48, 49, 50], "actatctcacaggagt": 3, "actctgctccagatr2": 49, "actctgctccagatr3": 49, "actgtcctctcggacg": 3, "actgtgaagaaattgc": 23, "action": [1, 2, 3, 16], "activ": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "activatior": 8, "active_ligand_target_link": 25, "actual": [1, 7, 13, 14, 15, 16, 19, 21, 23, 24, 25, 27, 28, 36, 41, 48], "acut": 2, "ad": [1, 2, 3, 4, 7, 10, 11, 13, 15, 16, 21, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 40, 41, 48, 51], "ad_auc_mtx": 26, "ad_g": 38, "ad_map": 38, "adam": [1, 5, 7, 9, 13, 22, 24, 25, 27, 28, 36, 43, 50, 51], "adameyko": [50, 51], "adamson": 49, "adapt": [3, 4, 5, 7, 8, 9, 11, 13, 16, 18, 23, 24, 26, 48], "adaptor": 24, "adata": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 48, 50, 51], "adata2": [19, 21], "adata_": [14, 27, 28], "adata_batch": 26, "adata_batch_top_tf": 26, "adata_bbknn": 7, "adata_bc": 3, "adata_bcr": [1, 2, 3, 4], "adata_bcr_tmp": 2, "adata_beniss": 3, "adata_benisse_out": 3, "adata_both": 27, "adata_cell_pop": 14, "adata_cell_typ": 14, "adata_celltypist": 5, "adata_conga": 3, "adata_copi": 14, "adata_donor": 14, "adata_emb": 5, "adata_ergo": 4, "adata_fil": 10, "adata_hvg": 7, "adata_log": 17, "adata_manag": 36, "adata_map": 38, "adata_measur": 38, "adata_mono": 14, "adata_mvi": 28, "adata_mvtcr": 3, "adata_new": 19, "adata_pair": 28, "adata_pb": 14, "adata_pert": 16, "adata_pp": [33, 34], "adata_predict": 38, "adata_process": 49, "adata_r": 17, "adata_raw": [7, 34], "adata_repl": 14, "adata_sa": 23, "adata_sc": [36, 38], "adata_scanvi": 7, "adata_scvi": [7, 13], "adata_seurat": 7, "adata_st": [36, 38], "adata_stim": 25, "adata_subset": 19, "adata_t": 16, "adata_tc": 3, "adata_tcr": [2, 3, 4], "adata_tcr_align": 4, "adata_tcr_tmp": 2, "adata_tcrdist": 4, "adata_tcrmatch": 4, "adata_temp": 48, "adata_tessa": 3, "adata_to_map": 5, "adata_to_map_aug": 5, "adata_usa": 23, "adata_vi": 36, "adata_view": 19, "adck4": 15, "add": [1, 2, 3, 4, 5, 7, 10, 11, 13, 14, 15, 19, 27, 28, 32, 33, 34, 36, 41], "add_dist": 4, "add_dot": 13, "add_edges_from": 27, "add_level_nam": 13, "add_nhood_express": 13, "add_nodes_from": 27, "addadi": 36, "addendum": 34, "addict": 16, "addit": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 43, 48, 49, 50], "addition": [1, 2, 3, 4, 6, 7, 10, 11, 13, 14, 15, 16, 23, 24, 25, 27, 28, 30, 32, 34, 36, 37, 38, 41, 43, 48, 49, 50, 51], "addmodel": 8, "address": [13, 14, 16, 19, 21, 22, 23, 25, 28, 30, 34, 39, 47, 49], "adelman": 16, "adem": [17, 26], "aden": 49, "adenovir": 49, "adequ": 49, "adgrg1": 8, "adhes": 25, "adiconi": 24, "adipocyt": 36, "aditi": [7, 11, 27, 28, 34, 48], "adj": [26, 27, 37], "adj_2d": 37, "adj_pval": 25, "adjac": [23, 26, 36, 37, 38, 49], "adjust": [3, 4, 7, 11, 13, 14, 15, 23, 33, 36], "adjustcount": 34, "adjusttext": [1, 25], "adkin": 24, "administr": 15, "adolesc": 16, "adopt": [21, 23, 30], "adri": 24, "adrian": [1, 17, 24], "adrienn": 16, "adt": [3, 16, 28, 43, 44, 45, 46, 47, 48], "adt_cit": 27, "adt_cite_bridg": 27, "adt_cite_queri": 27, "adt_cite_query_bridg": 27, "adt_iso_count": [27, 28], "adt_isotype_control": [27, 28], "adt_n_antibodies_by_count": [27, 28], "adt_pp": 28, "adt_pseudotime_ord": [27, 28], "adt_total_count": [27, 28], "adt_x_pca": [27, 28], "adt_x_umap": [27, 28], "adult": [15, 24], "adv": 48, "advanc": [0, 2, 4, 7, 14, 15, 16, 17, 21, 23, 24, 25, 28, 30, 37, 48, 49, 50, 51], "advantag": [1, 2, 4, 5, 14, 19, 21, 23, 24, 25, 31, 39, 48, 49], "advent": 29, "advers": 15, "advic": 7, "advis": [4, 7, 16, 22, 24, 28, 33, 34, 45], "ae": [8, 16], "aebersold": 48, "aert": [8, 9, 15, 26], "aertslab": [8, 26], "aevermann": 24, "af": [23, 50], "af_quant": 23, "af_xmpl_run": 23, "afb": 49, "affect": [5, 7, 13, 14, 15, 18, 23, 24, 26, 34], "affin": [1, 2, 4, 9, 23], "afford": 24, "aforement": [5, 16, 31, 34, 45], "aftab": 9, "after": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "afterward": [1, 3, 5, 6, 11, 19, 32, 34], "ag": [2, 5, 13, 14, 17], "ag_rfc": 16, "agaaatgagtgcctcg": 28, "agaat": 49, "agahi": 49, "again": [1, 2, 4, 5, 6, 7, 13, 14, 16, 19, 21, 23, 25, 27, 28, 36, 49, 50, 51], "against": [3, 4, 7, 13, 18, 22, 25, 26, 34, 43, 51], "agami": 5, "agcaggtaggctatgt": 7, "agent": [1, 2], "agerang": 2, "agg": [5, 14, 49], "agg_dict": 14, "aggatctaggtctact": [27, 28], "agglom": 50, "aggr_donor": 10, "aggreg": [6, 8, 11, 13, 14, 16, 19, 25, 34, 37, 38, 39], "aggregate_and_filt": 14, "aggregatebiovar": 14, "aggregatefeatur": 11, "aggress": 49, "agjy21": 28, "agnieszka": 13, "agnost": 23, "agonist": 5, "agrafioti": 2, "agraw": [7, 11, 27, 28, 34, 48], "agre": [13, 26, 29], "agreement": [8, 25, 32], "agrn": 3, "agtgcggagtaagggc": 7, "aguilar": 25, "ahead": [34, 44], "aheyon": 51, "ahlmann": 33, "ahm": [5, 14, 24, 38], "ahmad": 7, "ai": 50, "aibar": [8, 9, 15, 26], "aicd": 1, "aid": [7, 8, 15, 16, 26, 51], "aidyn": 7, "aik": 24, "aim": [3, 15, 16, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 36, 38], "aime": 51, "air": 4, "air_repertoir": 1, "aird": 24, "airr": [1, 2, 3], "airwai": 49, "aisasgggssgntii": 4, "aisha": [3, 4], "aislyn": 49, "aitchison": 13, "aivazidi": 36, "akartuna": 24, "akeson": 24, "aki": 2, "akiaiycqyoyv5jssrooa": 2, "al": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "al592183": 7, "al627309": [7, 11, 36], "alain": 25, "alam": [9, 25], "alan": [14, 19, 29], "aland": 23, "albeit": 25, "albert": [30, 49], "alberto": [25, 26], "albrecht": 22, "alder": 2, "aldex2": 13, "alejandro": [7, 11, 14, 16, 19, 22, 27, 28, 34, 48, 49], "alejo": 49, "aleksandar": 24, "aleksandr": 4, "aleksandra": [1, 5, 36], "aleksandrina": 36, "alemani": 49, "alen": 5, "alessandro": [4, 50, 51], "alevin": 51, "alevin_fry_gpl": 23, "alevin_fry_hom": 23, "alevin_fry_qu": 23, "alevin_map_dir": 23, "alevinqc": 23, "alex": [7, 14, 23, 24, 25, 49], "alexand": [2, 5, 6, 7, 11, 13, 14, 16, 17, 19, 23, 24, 26, 27, 28, 31, 34, 36, 48, 49, 50, 51], "alexandr": 17, "alexandra": [7, 11, 17, 24, 27, 28, 34, 48, 50], "alexandro": 14, "alexandrov": 49, "alexei": [14, 15, 16, 43], "alexej": 49, "alexi": 7, "alfr": 17, "algorithm": [0, 2, 3, 5, 6, 8, 15, 16, 18, 19, 23, 25, 31, 37, 38, 48, 50, 51], "alhamdoosh": 14, "ali": [2, 24, 25, 36], "alic": [2, 14, 17, 49], "alicia": [7, 8, 13, 23], "alida": 51, "alie": [7, 11, 17, 27, 28, 34, 48], "align": [3, 4, 7, 9, 11, 15, 16, 18, 24, 27, 34, 36, 38, 42, 49, 50, 51], "align_burnin": 27, "alik": 3, "alina": 16, "alison": 49, "alistair": 25, "alizadeh": 17, "all": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 47, 48, 49, 50, 51], "all_tumor": 49, "all_val": 49, "allan": [23, 24], "allel": 49, "allele_rep_thresh": 49, "allele_t": 49, "allelet": 49, "allen": [5, 49], "allevi": [13, 16, 36], "allison": [3, 4, 23, 24, 25], "allissa": 17, "alloc": [8, 19, 23, 38], "allon": [5, 6, 7, 17, 23, 24, 36, 49, 50], "allow": [1, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 36, 37, 44, 45, 48, 49, 50, 51], "alltfs_hg38": [8, 26], "alma": [36, 41], "almet": 25, "almodaresi": 23, "almond": 51, "almost": [1, 7, 13, 15, 21, 23, 24, 28, 36], "alo": [4, 50, 51], "alok": 7, "alon": [14, 19, 23, 25, 26, 30, 49], "along": [9, 13, 15, 16, 18, 23, 28, 34, 36, 49, 50, 51], "alongsid": 13, "alonso": [15, 25, 26], "alper": 11, "alpha": [1, 4, 11, 13, 14, 33, 37, 38, 49, 51], "alpha_divers": [1, 3], "alpha_g": 51, "alphanumer": [10, 21, 23], "alreadi": [1, 2, 3, 4, 5, 6, 7, 11, 14, 17, 19, 21, 23, 24, 26, 31, 32, 33, 36, 37, 38, 43, 45, 48, 49, 50, 51], "also": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 45, 46, 47, 48, 49, 50, 51], "alt": 5, "alt_var": 36, "alter": [23, 25], "altern": [1, 2, 4, 5, 11, 13, 15, 16, 19, 21, 23, 24, 25, 26, 28, 36, 39, 49], "altexpnam": [7, 21], "although": [1, 5, 7, 13, 14, 15, 19, 21, 23, 24, 25, 30, 34, 43, 50, 51], "alunni": 51, "alv": 25, "alvarez": 23, "alvaro": 3, "alveolar": 5, "alwai": [5, 7, 8, 13, 15, 16, 19, 21, 22, 24, 29, 33, 43, 49], "alzheim": 51, "amalia": 29, "aman": 38, "amanda": [5, 15, 17, 24, 49, 50], "amaz": 49, "amazonaw": 2, "amb17": 1, "amber": 2, "ambient": [23, 33, 47, 48], "ambigu": [2, 4, 23], "ambridg": 50, "ambros": 23, "amedeo": 17, "amelia": [37, 41], "american": 49, "amezquita": 22, "ami": [24, 49], "amino": [1, 2, 3, 4, 18, 24], "aminoacid": 1, "amir": [9, 13, 14], "amiri": 7, "amit": [2, 17, 23, 24, 36, 50, 51], "ammar": 29, "amnon": 13, "amodio": 16, "among": [3, 5, 7, 13, 14, 15, 16, 23, 25, 26, 36, 39, 49], "amongst": 49, "amount": [0, 1, 2, 3, 4, 5, 7, 13, 14, 18, 24, 26, 29, 31, 34, 48], "amp": 50, "amplicon": [13, 49], "amplif": [18, 23, 24], "amplifi": [9, 13, 18, 23, 24], "amrut": 36, "amulet": 11, "amulet_neglog10qv": 11, "amulet_pv": 11, "amulet_qv": 11, "amulet_result": 11, "amulet_scores_": 11, "amz": 2, "an": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 46, 47, 48, 49, 50, 51], "ana": [13, 24], "anaconda": [5, 8, 11, 13, 26], "anaconda3": [13, 25], "analog": [11, 13, 19, 22, 23, 47, 49], "analogi": 25, "analys": [1, 7, 10, 11, 14, 15, 18, 19, 21, 23, 24, 25, 48, 49, 51], "analysi": [0, 5, 6, 7, 8, 11, 17, 18, 21, 23, 24, 25, 27, 29, 30, 31, 32, 33, 34, 37, 38, 39, 41, 48, 50, 51], "analyst": [6, 13, 15, 21, 24, 30, 32, 33, 36, 49], "analyt": [15, 30, 49], "analytic_pearson": 33, "analytic_pearson_residu": 33, "analyz": [0, 1, 2, 3, 5, 8, 9, 11, 13, 15, 18, 19, 22, 23, 24, 30, 33, 37, 39, 40, 41, 48, 49, 50, 51], "anand": 1, "anastasi": 23, "anastasia": [13, 14, 15, 21, 23, 27, 28], "anastasiya": 4, "ancestor": 50, "ancestr": [3, 4, 49], "ancestri": 49, "anchor": [7, 18, 26, 27], "anchorset": [7, 27], "ancom": 13, "ander": [14, 19, 22], "andersen": [5, 14, 19, 27, 28], "anderson": [14, 16], "andersson": [36, 41], "andr": [23, 25, 48, 50], "andra": 49, "andrad": 11, "andrea": [2, 13, 17, 23, 24, 26, 29, 48, 51], "andreani": 11, "andrew": [3, 4, 5, 7, 8, 9, 13, 14, 16, 17, 19, 23, 27, 28, 47, 50], "andrusivova": 7, "andrzej": [19, 22, 23], "anemia": 24, "ang": [1, 7], "angela": [5, 7, 11, 14, 16, 19, 27, 28, 34, 48], "angelidi": 7, "anger": [2, 19], "angl": 5, "anh": [15, 26], "ani": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 30, 34, 36, 45, 48, 49, 51], "anika": 51, "anil": [14, 16], "anim": 9, "anindita": [23, 24, 50], "anja": [5, 15, 40], "anjan": 24, "ank1": 26, "ann": [2, 7, 11, 23, 27, 28, 34, 48, 49], "anna": [4, 5, 6, 7, 8, 11, 16, 17, 19, 23, 24, 26, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "annal": 49, "annalena": 50, "anndata": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 18, 23, 25, 26, 27, 28, 30, 32, 33, 34, 36, 37, 38, 40, 43, 48, 50, 51], "anndata2ri": [7, 11, 14, 15, 17, 21, 25, 27, 28, 31, 32, 33, 34], "anndata2sc": 21, "anno_col": 13, "annoamc": 5, "annocol": 8, "annocxj": 5, "annoehp": 5, "annofg": 5, "annohhan": 5, "annohz21": 5, "annoi": 7, "annoklmst": 5, "annoknw": 5, "annolnl": 5, "annolrc": 5, "annopm22": 5, "annoprojoariassb21": 5, "annopst19": 5, "annoslc": 5, "annosmal": 17, "annosramirezsuastegui": 5, "annot": [1, 2, 3, 4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 28, 29, 34, 36, 37, 38, 40, 44, 45, 49, 50], "annotat": 4, "annotate_1": 8, "annotate_nhood": 13, "annotate_nhoods_continu": 13, "annotateddatafram": 17, "annotation_adata_out": 5, "annotation_list": 38, "annotationdbi_1": 8, "annotations_fnam": 26, "annotwve19": 5, "annowry16": 5, "annowsf": 5, "annozen22": 5, "annozkt19": 5, "annozoflanaganc": 5, "annual": [4, 49], "anoop": 49, "anoth": [1, 4, 5, 6, 7, 9, 11, 13, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 36, 40, 48, 49], "anoushka": 24, "anpep": 27, "ansari": [3, 5, 7, 50, 51], "anscomb": 41, "anslei": 5, "ansuman": 3, "answer": [2, 3, 4, 7, 8, 13, 14, 15, 16, 21, 24, 25, 26, 42, 50], "answer_color": 42, "anthoni": [32, 33, 34, 49], "anti": [13, 23], "antia": 2, "antibodi": [2, 3, 4, 5, 16, 17, 28, 43, 47, 48], "anticip": 49, "antigen": [2, 3, 4], "antiprolif": 14, "antisens": 23, "antivir": 14, "antoin": [5, 7, 14, 17, 26, 50], "antonet": 16, "antonio": [13, 14, 23], "anupriya": 17, "anur": 49, "anyio": [1, 21], "anymor": [1, 2, 3, 4, 13, 19], "anyth": [19, 28], "anywai": 28, "anywher": 49, "ao": 37, "aohl21": 25, "aoki": 5, "ap11": 2, "ap6": [1, 4], "apach": 30, "apalategui": 29, "aparicio": [5, 14], "aparna": 5, "apart": [7, 21, 40, 45], "apbb1": 8, "apca": 27, "api": [30, 49], "aplic": 15, "apoptosi": 25, "appar": [13, 19, 48], "appdata": 17, "appear": [1, 7, 13, 14, 18, 19, 23, 24, 28, 29, 34, 36, 40, 49], "append": [3, 5, 7, 15, 34, 48, 49], "apperloo": [5, 7, 50], "appl": 15, "appli": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 29, 33, 34, 36, 37, 38, 44, 45, 48, 49, 50, 51], "applic": [3, 4, 7, 11, 13, 15, 16, 19, 23, 24, 25, 30, 33, 38, 39, 49, 50, 51], "apply_1": [25, 27, 28], "appnop": [7, 15, 21], "apport": 23, "appreci": 1, "approach": [2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 27, 30, 32, 33, 36, 37, 39, 40, 41, 43, 45, 47, 49, 50, 51], "appropri": [1, 4, 7, 13, 16, 17, 21, 23, 31, 48, 50], "approv": [6, 14], "approx": 13, "approxim": [3, 8, 13, 16, 23, 26, 31, 32, 33, 49, 50, 51], "apr": [4, 5, 14, 24, 25, 47, 48], "april": [7, 9, 13, 23, 36, 51], "aqueou": 18, "aquino": 26, "ar": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "ara": 26, "arac": 25, "arampatzi": 50, "aran": 17, "arang": [15, 19], "aravind": 15, "arbitrari": [3, 4, 5, 7, 14, 15, 21, 23, 32, 33, 38], "arbitrarili": 21, "arbores": 23, "arc": [11, 18, 51], "archer": 24, "arches_param": 27, "architectur": [3, 16, 38], "archr": 9, "ardgenvldi": 4, "area": [1, 16, 21, 22, 23, 24, 25, 26, 36, 37, 49], "arfa": 14, "arg": [7, 21, 27, 28, 38, 42, 49], "argcomplet": 21, "argelaguet": [7, 28], "argmin": 50, "args_swarmplot": 13, "argsort": 32, "argu": 49, "arguabl": 3, "arguel": [5, 7, 50], "argument": [4, 7, 11, 13, 19, 21, 23, 31, 34, 36, 38, 40], "ari": 28, "ari_": 28, "ari_clust": [7, 28], "aria": 5, "ariann": 13, "ariel": [7, 13, 14, 16, 23], "arik": [17, 26], "arioth": 23, "aris": [7, 14, 16, 23, 28, 49], "arisen": 23, "arithmet": 16, "aritra": 16, "armingol": 25, "arni": 14, "arnol": 28, "arnold": [3, 4], "arnon": 16, "around": [1, 5, 7, 8, 11, 13, 14, 23, 36, 40, 46, 48, 49, 51], "arpack": [19, 31, 45], "arpan": 37, "arrai": [1, 4, 5, 11, 13, 14, 16, 19, 24, 25, 26, 27, 30, 37, 40], "arrang": [1, 25], "array_col": [36, 37], "array_row": [36, 37], "array_split": 14, "arrayexpress": 3, "arraylik": [11, 36], "arriv": 38, "arrow": 21, "arrow_10": 8, "arswnsnygeyyfdi": 4, "art": 31, "artefactu": [11, 23], "artem": 36, "arthur": [15, 43], "arti": 37, "articl": [2, 4, 5, 9, 11, 13, 14, 16, 17, 19, 24, 25, 27, 28, 31, 33, 34, 36, 38, 39, 40], "artifact": [11, 14, 23, 36, 48, 50, 51], "artifici": [7, 11, 16, 18, 23, 34], "artyomov": [15, 17], "arun": 7, "arup": 43, "arutyunyan": 36, "arxiv": [2, 5, 13, 14, 16, 17, 19, 22, 23, 24, 27, 28, 29, 33, 38, 47, 48, 50, 51], "aryan": 36, "arye": 32, "aryeh": 49, "aryfgnlfamdf": 4, "aryygnlyamdi": 4, "as1": [7, 8], "as_tibbl": 25, "asa": 11, "asami": 49, "asap": 48, "asarrai": 37, "ascend": [5, 15, 16, 26, 49, 51], "ascertain": 25, "aschenbrenn": [17, 26], "ascii": 18, "asciitre": 1, "ash": 17, "ashcroft": 1, "ashenberg": [7, 50], "ashlei": 25, "ashuach": [7, 9, 15, 28], "asic5": 15, "asid": 23, "ask": [7, 16, 23], "askpass_1": 8, "asp": 36, "aspect": [3, 15, 19, 24, 48, 49], "asrpsglntdtqi": 4, "assai": [2, 7, 8, 11, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 32, 36, 38, 39, 48, 49, 50], "assaycent": 8, "assaydata": 17, "assdsstdtqi": 4, "assembli": [2, 18, 24, 26], "assert": [15, 27, 38, 50], "assertthat_0": 8, "assess": [5, 7, 8, 11, 13, 14, 15, 17, 23, 25, 26, 28, 33, 34, 36, 38, 41, 49, 51], "assign": [1, 3, 4, 5, 7, 11, 13, 15, 16, 23, 24, 25, 36, 37, 38, 49, 50, 51], "assign_diseas": 4, "assipgavheqi": 3, "assldardrgrvteaf": 3, "associ": [2, 4, 5, 7, 8, 11, 13, 15, 17, 18, 19, 22, 23, 24, 25, 26, 34, 36, 41, 49, 51], "asspgtgtygyt": 3, "asspqtgvarygyt": 3, "assqtggqpqh": 4, "assum": [2, 3, 4, 8, 11, 13, 14, 15, 19, 23, 25, 27, 33, 34, 36, 41, 47, 51], "assumpt": [1, 11, 14, 16, 19, 24, 34, 36, 41, 49, 51], "assyggyneqf": 4, "astrid": [7, 36], "astro": 16, "asttoken": [7, 15, 21, 25], "astyp": [1, 2, 3, 4, 7, 11, 13, 14, 15, 17, 25, 27, 36, 37, 46, 49], "asw": [7, 28], "asw_label": [7, 28], "asymmetr": 49, "asymptomat": 2, "asynchron": 50, "at1": 49, "atac": [7, 10, 11, 19, 22, 27, 28, 50], "atac_atac_frag": [7, 27, 28], "atac_blacklist_fract": [7, 27, 28], "atac_df": 8, "atac_frag": [10, 11, 19], "atac_gene_act": [7, 27, 28], "atac_gene_activity_var_nam": [7, 27, 28], "atac_hvf": 28, "atac_hvf_muon": 27, "atac_lsi_ful": [7, 27, 28], "atac_lsi_r": [7, 27, 28], "atac_multiom": 27, "atac_multiome_queri": 27, "atac_ncount_peak": [7, 27, 28], "atac_nucleosome_sign": [7, 27, 28], "atac_peak": 19, "atac_peak_annot": [11, 19], "atac_pseudotime_ord": [7, 27, 28], "atac_qc_filt": 11, "atac_qc_metr": 11, "atac_reads_in_peaks_frac": [7, 27, 28], "atac_umap": [7, 27, 28], "atacargy22": 9, "atacbgbmp": 9, "atacbgonzalezbmp": 8, "atacbkh19": 9, "ataccla": 11, "atacfpl": 9, "atacgcp": 9, "atacglm": 11, "atacigs22": 9, "atackdh": 8, "ataclbc": 11, "atacmftg22": 9, "atacmk22": 9, "atacnpa": 9, "atacsf12": 8, "atacssls20": 9, "atacswbg17": 8, "atactem": 11, "atak": 26, "atatc": 49, "atbks22": 19, "atchley_factor": 3, "atefeh": 24, "atgaagccagggagct": 7, "athcg": 19, "athhan": 19, "atio": 47, "atjup22": 19, "atkfm": 19, "atla": [5, 7, 13, 24, 28, 37, 50], "atlas": [5, 29], "atlass": 13, "atp": 9, "atp2a2": 36, "atp6v1e2": 15, "atpsk": 19, "atscv22": 19, "atsm22a": 19, "atsm22b": 19, "atss22": 19, "atssf": 19, "attach": [2, 8, 9, 15, 18, 23, 24, 25, 27, 28, 48], "attack": 37, "attcctagtccaagag": 27, "attcgtttcagtattg": 7, "attempt": [7, 8, 13, 14, 16, 17, 23, 25, 27, 51], "attent": [1, 23], "attgg": 49, "attggacagccatcgc": 3, "attila": 51, "attolini": 14, "attr": [1, 7, 21], "attract": [2, 23], "attribut": [1, 2, 3, 5, 7, 15, 16, 25, 27], "atul": 17, "atvrt": 19, "atwat18": 19, "aubrei": 17, "auc": [16, 26], "auc_mtx": 26, "auc_threshold": 26, "aucel": 26, "aucell_1": 8, "aucell_estim": 15, "audienc": 30, "aug": [2, 16, 24, 47, 49], "augur_mod": 16, "augur_results1": 16, "augur_results2": 16, "augur_scor": 16, "august": [2, 5, 7, 23, 24, 26, 36, 50, 51], "augustin": [13, 16], "aupr": 25, "aupr_correct": 25, "aurelien": 15, "auroc": 25, "auror": [5, 7, 50], "aur\u00e9lien": 25, "austin": [4, 5, 7, 27, 50], "author": [0, 3, 22, 30], "auto": [5, 6, 15, 19, 27, 50], "autocorrel": 41, "autocrin": 1, "autodevic": 27, "autoencod": [3, 5, 27, 28], "autoestcont": 34, "autogen": 17, "autom": [19, 23, 24, 29, 30, 51], "automat": [2, 5, 7, 11, 13, 17, 18, 19, 21, 23, 24, 28, 34, 48], "autonotebook": [5, 6, 15, 50], "av20": 49, "avail": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 33, 36, 37, 38, 39, 47, 48, 49, 50], "avasthi": 38, "averag": [3, 4, 11, 13, 14, 16, 18, 19, 23, 24, 25, 32, 33, 34, 36, 38, 40, 51], "avg": 1, "avi": [5, 9, 14, 15, 19, 23, 27, 28, 51], "avid": 3, "avinash": 7, "aviv": [5, 6, 7, 13, 22, 23, 24, 25, 38, 48, 50], "avoid": [1, 2, 3, 4, 5, 7, 8, 11, 14, 17, 19, 21, 23, 32, 34], "avraham": 38, "avsec": 5, "awai": [5, 24, 25, 49], "await": [2, 4, 49], "awar": [13, 15, 23, 24, 25, 39], "awf": 49, "awk": 23, "aws4": 2, "aws4_request": 2, "ax": [1, 4, 5, 7, 8, 11, 13, 14, 15, 16, 19, 23, 25, 26, 32, 33, 36, 38, 44, 48, 49], "ax_col_dendrogram": 4, "ax_row_dendrogram": 4, "axel": [17, 25, 26], "axessubplot": [3, 4, 7, 17, 49], "axhlin": [11, 13, 49], "axi": [3, 4, 5, 7, 8, 11, 14, 15, 16, 23, 25, 26, 27, 28, 36, 44, 49], "axis_kei": 16, "axisarrai": [19, 44], "axisgrid": [13, 48], "axvlin": [11, 26, 49], "ayan": 15, "ayoung": 26, "ayshwarya": [7, 38], "azad": 17, "azim": 25, "azimuth": 5, "b": [1, 2, 3, 4, 5, 6, 7, 12, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 28, 29, 37, 41, 43, 44, 45, 46, 49, 50, 51], "b1": [5, 7, 12, 13], "b10": 13, "b10_ttaggtctagactc_salmonella_goblet": 13, "b10_ttagtcaccatggt_salmonella_ta": 13, "b10_ttatggcttaacgc_salmonella_ta": 13, "b10_ttcatcgaccgtaa_salmonella_ta": 13, "b10_ttgaacctcatttc_salmonella_ta": 13, "b10_tttcacgacaagct_salmonella_ta": 13, "b10_tttcagtgaggcga_salmonella_enterocyt": 13, "b10_tttcagtgcgacat_salmonella_stem": 13, "b10_tttcagtgtgacca_salmonella_endocrin": 13, "b10_tttcagtgttctca_salmonella_enterocyt": 13, "b18cb63ca03820e07cb8b3d9375466ca6405e655822269f5ae36d7449a28b810": 2, "b1_aaacataccacaac_control_enterocyt": 13, "b1_aaacgcacgaggac_control_stem": 13, "b1_aaacgcactagcca_control_stem": 13, "b1_aaacgcactgtccc_control_stem": 13, "b1_aaacttgaccacct_control_enterocyt": 13, "b1_aaaggcctaaggcg_control_stem": 13, "b1_aacacgtgatgctg_control_ta": 13, "b1_aacttgctggtatc_control_enterocyt": 13, "b1_aagaacgatgactg_control_enterocyt": 13, "b1_aattacgaaacaga_control_enterocyt": 13, "b2": 13, "b2m": [4, 14, 25], "b3": 13, "b4": 13, "b5": 13, "b6": 13, "b7": 13, "b8": 13, "b9": 13, "b_cell": 14, "b_cells_1": 17, "b_cells_2": 17, "b_plasma_ct": 5, "b_plasma_mark": 5, "ba": [14, 17, 26], "baaijen": 14, "babel": [1, 21], "bacardit": 50, "bach": [1, 2, 29], "bach2": [5, 12], "back": [1, 4, 5, 7, 13, 14, 19, 23, 24, 25, 26, 27, 28, 36, 38, 42, 45, 47], "back_color": 42, "back_font_s": 42, "backcal": [1, 7, 15, 21, 25], "backend": 5, "backfac": 42, "backflow": 51, "background": [3, 8, 9, 13, 15, 18, 22, 25, 27, 28, 30, 34, 42, 47, 48], "background_expressed_gen": 25, "background_gen": 25, "background_gradi": 7, "backports_1": 25, "backtrac": 23, "backup_url": [5, 15, 25, 31, 32, 33, 34, 36, 38, 43, 48], "bacteri": [13, 24], "bacteriophag": 24, "bad": [13, 23, 29, 38], "badger": [48, 50], "badia": 15, "bae": [26, 49], "bagaev": 4, "bagdatli": 9, "bage5": 19, "baghdassarian": 25, "baglaenko": [7, 44], "bagnoli": 24, "baharak": [5, 7, 50], "bahlo": 6, "bai": [23, 49], "bailei": 49, "bakhti": 51, "bakken": 24, "balanc": [7, 13, 14, 27, 30, 49], "balanced_sampl": 3, "balancing_weight": 27, "balasubramanian": 24, "baldr": 2, "bali": 2, "ballk": 40, "balogh": 50, "balvert": 14, "bam": [18, 23], "bambouskova": 17, "banchereau": 11, "banchero": 5, "band": 23, "bang": 50, "banovich": [5, 7, 50], "bao": 37, "baoguo": 36, "baom": 37, "baptista": 50, "bar": [1, 7, 15, 18, 24, 41, 49], "baraa": 23, "barak": [13, 24], "barbanson": [14, 50], "barbara": [7, 17, 25], "barbri": [5, 7, 24, 50], "barcel": 13, "barcod": [2, 3, 4, 9, 11, 13, 16, 18, 19, 24, 27, 34, 39, 41, 48, 49], "bare": 13, "baril": 51, "barkan": 24, "barker": [50, 51], "baron": [7, 17, 49, 50], "barplot": [1, 13], "barr": [4, 24], "barraud": [14, 16], "barrio": 3, "bart": 50, "barton": [2, 24], "baruzzo": 25, "base": [1, 2, 3, 4, 6, 8, 9, 13, 14, 15, 16, 17, 18, 19, 22, 25, 26, 27, 28, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 43, 46, 47, 48, 49, 50, 51], "base64enc_0": [8, 25], "base_famili": 8, "base_s": [1, 4], "basel": 14, "baselin": [2, 15, 36], "bash": 4, "bashford": 48, "bashrc": [3, 4], "basi": [5, 7, 15, 19, 24, 26, 28, 29, 31, 50, 51], "basic": [2, 4, 14, 16, 17, 18, 21, 22, 23, 24, 25, 26, 30, 33, 34, 37, 38, 49], "basilisk": [8, 21], "basilisk_1": 8, "bassler": 7, "bastiaan": [7, 49], "bastian": [7, 11, 27, 28, 34, 48], "bastida": 51, "basu": [23, 24], "batch": [5, 8, 14, 15, 16, 18, 24, 26, 27, 28, 33, 34, 36, 43, 45, 46, 47, 48], "batch_color": [7, 13, 14, 27, 28, 43, 44, 45], "batch_condit": 36, "batch_correction_metr": 28, "batch_kei": [7, 13, 16, 26, 27, 28, 36], "batch_list": 7, "batch_siz": [16, 36], "batchbench": 7, "batches_to_keep": 28, "batll": 24, "battich": 50, "batut": 23, "bay": [7, 14, 15, 36], "bayann": 50, "bayesian": [3, 13, 49, 51], "bayesspac": 37, "bayraktar": [5, 25, 36], "bbab035": 5, "bbab265": 17, "bbc57": 31, "bbk20": 2, "bbknn": 7, "bbox_to_anchor": [1, 28], "bbr": 49, "bbw057": 14, "bc": 13, "bcdc22": 25, "bcl": 23, "bcl11a": [5, 12], "bcl11b": 12, "bcl2": [5, 12], "bcr": [2, 19], "bcr2_logo_motif": 1, "bcr_00_gex": 3, "bcr_00_read_align": [2, 3], "bcr_01_preprocess": [2, 3, 4], "bcr_cellrang": 2, "bcr_filter": 1, "bcr_logo_motif": 1, "bcv": 14, "bdata": 19, "bdg": 49, "bead": [2, 9, 23, 24], "bear": [19, 38], "beat": [23, 24], "becaus": [0, 1, 2, 3, 5, 7, 8, 13, 14, 16, 18, 19, 21, 23, 24, 25, 27, 45, 48, 49], "becavin": [7, 50], "becht": 22, "becker": [17, 26], "beckstett": [17, 26], "becom": [1, 6, 11, 21, 22, 23, 24, 25, 29, 34, 36, 49, 50], "bed": [11, 19], "been": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 34, 37, 38, 41, 44, 45, 48, 49, 50, 51], "beerenwinkel": 14, "beeswarm_0": 8, "befor": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "beforehand": 23, "begin": [2, 8, 9, 19, 24, 38, 49, 50, 51], "beginn": [22, 30, 33], "behav": [19, 30, 49], "behavior": [4, 19, 23, 34, 49], "behaviour": [1, 15, 38], "behavour": [7, 11], "behind": [1, 2, 7, 19, 30], "behjati": [23, 34, 50], "behren": 9, "beid": 49, "beij": [8, 50], "beilina": 17, "being": [1, 2, 3, 4, 7, 8, 11, 14, 16, 18, 21, 23, 24, 25, 30, 33, 34, 36, 37, 49], "bel": 7, "belaid": 11, "belein": 50, "belgrad": [23, 24], "believ": [13, 23, 49], "belinda": [7, 14, 15], "bell": [23, 49], "bellman": 31, "belong": [1, 3, 5, 7, 13, 14, 15, 16, 18, 19, 23, 25, 36, 37, 38, 40, 49], "below": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 16, 19, 21, 23, 24, 26, 27, 34, 48, 49], "beltram": [7, 23, 51], "ben": 24, "benc": 25, "benchmark": [4, 5, 8, 9, 11, 14, 15, 17, 18, 22, 23, 24, 26, 27, 28, 30, 33, 34, 36, 38, 48, 49], "benedict": 24, "benedikt": [19, 37, 40, 41], "benefici": [13, 14, 15, 23, 30, 33, 43], "benefit": [1, 23, 30, 31, 34, 45], "benhamm": 23, "benhar": 7, "benilton": [19, 22], "benisse_bcr": 3, "benisse_bcr_contig": 3, "benisse_clust": 3, "benisse_encoded_bcr": 3, "benisse_gex": 3, "benjamin": [1, 3, 14, 15, 17, 23, 24, 26, 39, 41], "benjamini": [13, 14], "benson": 2, "bent": [23, 24], "benthem": 14, "beppu": [23, 24], "beren": 31, "berg": [5, 7, 14, 50], "bergen": [50, 51], "bergenstr": 7, "bergenstr\u00e5hl": 36, "berger": 7, "berkelei": 50, "berlin": [7, 21, 42], "bernadett": 16, "bernard": [7, 11, 24, 27, 28, 34, 48], "bernett": 17, "bernhard": [26, 51], "bernoulli": [18, 28], "bernstein": 23, "bert": 49, "berta": 25, "bertagnolli": 24, "berthold": [6, 50, 51], "bertil": 23, "bertram": 15, "bertrand": [5, 14, 16, 19, 27, 28, 48, 50], "berub": 49, "besid": [1, 11], "best": [3, 5, 7, 8, 9, 11, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 34, 36, 41, 44, 49, 50, 51], "best1": 8, "best_model_by_metr": 3, "best_practic": 10, "best_practices_annot": 5, "best_practices_regulons_rnanatac": 8, "best_trial": 3, "bestpractic": 4, "bestpracticestart": 1, "beta": [1, 4, 14, 15, 25, 37, 51], "beta_": 36, "beta_g": 51, "beta_ufunc": [1, 7, 15, 21, 25], "beth": 49, "better": [1, 2, 3, 4, 5, 6, 7, 11, 12, 13, 14, 15, 16, 17, 18, 23, 24, 25, 28, 33, 34, 36, 38, 41, 48], "bettina": 24, "between": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 39, 41, 44, 47, 48, 49, 50, 51], "beumer": 50, "beyaz": [13, 22], "beyer": 48, "beyond": [1, 13, 19, 23, 29, 30, 49, 50, 51], "bfgp": 25, "bg_color": 42, "bgcv01_aaacctgagaccggat": 4, "bgcv01_aaacctgaggaactgc": 4, "bgcv01_aaacctgagggatctg": 4, "bgcv01_aaacctgcaacgcacc": 4, "bgcv01_aaacctgcacgtgaga": 4, "bgll08": 6, "bh": 13, "bharadwaj": [23, 24], "bhattacherje": 16, "bhattacherjee_15": 16, "bhattacherjee_48": 16, "bhattacherjee_adata": 16, "bhattacherjee_adata_15": 16, "bhattacherjee_adata_15_permut": 16, "bhattacherjee_adata_48": 16, "bhattacherjee_adata_48_permut": 16, "bhattacherjee_results_15": 16, "bhattacherjee_results_15_permut": 16, "bhattacherjee_results_48": 16, "bhattacherjee_results_48_permut": 16, "bhupesh": 50, "bhutani": 24, "bi": 23, "bia": [4, 7, 13, 14, 18, 23, 24, 25, 34, 41], "biala": [23, 24], "biancalani": 38, "bias": [4, 5, 7, 13, 17, 23, 24, 26, 32, 47, 49], "bib": [5, 14, 17], "bic": 41, "bichao": 37, "biddi": 49, "bidirect": 15, "bieberich": 2, "biela": [23, 24, 37], "bifurc": [49, 50], "big": [7, 15, 24, 29, 36, 45], "bigger": [5, 7], "biggest": [0, 1, 19], "bihan": 23, "bijan": 49, "bijb19": 2, "biject": 23, "bilali": 1, "billion": [18, 23], "bimod": [1, 13, 23], "bin": [7, 8, 9, 11, 13, 21, 23, 24, 26, 33, 34, 36, 38, 49], "bin_path": 8, "binar": [9, 28], "binari": [13, 18, 19, 21, 27, 28, 48], "bind": [2, 3, 4, 8, 9, 18, 24, 25, 26, 47, 48], "bind_row": 25, "bindel": 36, "binder": 4, "binding_fullir": 4, "binding_ham": 4, "bing": [9, 15, 50], "bingyi": 25, "binom_ufunc": [1, 7, 15, 21, 25], "binomi": [14, 15, 18, 28, 32, 33, 36, 41, 47, 48], "binomial_devi": 32, "binrang": 11, "binstadt": 2, "bio": [1, 7, 27, 28], "bio_conservation_metr": 28, "bioarxiv": 51, "biobank": 24, "biobas": [7, 17, 21], "biobase_2": [8, 15, 27, 28], "bioc_h5mu_fil": 21, "biocgener": [7, 21], "biocgenerics_0": [8, 15, 25, 27, 28], "biochem": 25, "biocio_1": 8, "biocmanag": 8, "bioconda": [5, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 25, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 51], "bioconductor": [7, 8, 11, 13, 14, 15, 19, 25, 27, 28, 31, 32, 33, 34], "biocparallel": [33, 34], "biocparallel_1": 8, "bioinformat": [1, 2, 4, 5, 7, 13, 14, 15, 16, 17, 19, 23, 24, 25, 30, 41, 47, 50], "bioinformatician": [5, 30], "biol": [26, 37], "biolog": [1, 5, 7, 9, 14, 15, 16, 17, 18, 19, 23, 25, 26, 29, 30, 32, 33, 34, 36, 38, 39, 45, 48, 49, 50, 51], "biologi": [0, 1, 2, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 28, 29, 30, 32, 33, 34, 36, 39, 41, 48, 49, 50, 51], "biologist": [5, 30], "biomedcentr": 11, "biometr": 33, "biomolecul": 18, "bionti": [49, 50, 51], "biophys": 47, "biorend": [2, 9], "biorxiv": [3, 5, 7, 9, 13, 14, 15, 16, 19, 23, 25, 27, 28, 29, 37, 41, 47, 48, 49, 50], "bioscienc": [7, 24], "biostatist": [7, 14], "biostrings_2": 8, "biotechnol": 37, "biotechnologi": [3, 5, 6, 7, 13, 14, 15, 16, 17, 23, 24, 25, 27, 36, 39, 48, 49, 50, 51], "biotinyl": 48, "bipot": 5, "birgit": [17, 26], "bit": [5, 8, 15, 21, 25, 27, 28], "bit64": 21, "bit64_4": 8, "bit_4": 8, "biton": [13, 22], "bitop": [7, 21], "bitops_1": [8, 15, 25, 27, 28], "bivona": 49, "bizzotto": 49, "bj": [15, 24], "bjoern": 4, "bjorkman": 4, "bkk": 49, "bkp_path_ciscorr": 8, "bl": 15, "bla": [8, 9, 15, 25, 26, 27, 28], "blaauw": 51, "black": [5, 11, 49], "blackburn": [2, 24], "blacklist": 11, "blacklist_fract": 11, "blacklist_repeats_segdups_rmsk_hg38": 11, "blake": 4, "blattman": 2, "blaxal": 23, "blish": [5, 14, 19, 25, 27, 28], "blk": [5, 12], "blob": 7, "blob_1": 8, "block": [4, 13, 42], "blockad": 3, "blogpost": 13, "blondel": 6, "blood": [2, 5, 14, 16, 19, 24, 49, 50, 51], "bloom": [7, 11, 27, 28, 34, 48], "blosum": 4, "blue": [7, 11, 13, 14, 15, 23, 26], "blueprint": 17, "blyth": 1, "bmc": [1, 13, 14, 15, 17, 23, 26, 50], "bmp_0": 8, "bo": [16, 37, 48, 49, 50], "boaz": 24, "bob": 23, "bodi": [2, 9, 24, 30], "boettcher": 51, "bogdan": 17, "bohao": 25, "bohrson": 49, "boi": 25, "boil": 13, "boland": 4, "bold": 42, "boldsymbol": 36, "bolker": 14, "bollback": 49, "bolster": 49, "bolt": [5, 7, 50], "bomb": 37, "bonaguro": [17, 26], "bond": [18, 48], "bone": [2, 5, 7, 28, 34, 48], "bonhoeff": 1, "boni": [7, 11, 27, 28, 34, 48], "bonk": 24, "bonn": 17, "bonnar": 16, "bonni": 7, "booeshaghi": [23, 51], "book": [0, 2, 3, 5, 19, 21, 31, 34, 37, 40, 50], "bool": [1, 13, 15, 32], "boolean": 19, "boor": 36, "bootstrap": 13, "borcherd": 2, "border": [5, 42], "borderaxespad": 28, "bore": 30, "bori": 15, "borm": [50, 51], "bormann": 2, "bort": 49, "bose": 23, "bosiljka": 24, "bosing": 2, "bosquillon": [17, 26], "boss": 5, "bot": [1, 2, 25, 50], "both": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 36, 37, 38, 39, 41, 42, 44, 46, 48, 49, 50, 51], "bottino": 40, "bottleneck": 16, "bottom": [11, 23, 25, 42], "boucher": 5, "boudewijn": 14, "bouka": 51, "bouman": 51, "bound": [2, 24, 48], "boundari": [11, 37, 51], "bourgain": [39, 41], "boutet": 24, "bowen": [17, 26], "box": [23, 42], "boxplot": [5, 13, 17, 48], "boyang": 14, "boyeau": [7, 36], "bp": [7, 24, 50], "bp2": 19, "bp_pp": 6, "bpparam": 33, "br": [23, 42], "bracer": 2, "bracken": 16, "brad": 49, "bradlei": 3, "braeun": 24, "brai": 23, "brain": [15, 23, 24, 37, 49], "brainbow": 49, "brake": 51, "brampton": 24, "branch": [5, 49, 50], "branco": [50, 51], "brandon": [15, 23], "braun": [7, 50, 51], "braunger": 15, "bravo": [8, 9, 15, 19, 22, 26], "breadth": 5, "break": [1, 2, 8, 23, 49], "breakdown": 5, "breakpoint": 1, "breaks_pretti": 8, "bredikhin": [19, 28, 48], "brenner": [7, 44], "brent": 49, "brewer_heat": 8, "brewer_purpl": 8, "brian": [2, 7, 15, 16, 17, 23, 24, 47, 48, 49, 50], "brickman": 25, "bridg": [2, 48], "bridget": 17, "bridi": [3, 4], "brief": [5, 14, 17, 25, 49], "briefli": [8, 15, 21, 24, 49], "brien": 51, "brigg": [1, 50], "brighter": 14, "brigitt": 51, "brill": 13, "brinei": 2, "bring": [19, 29, 48], "brink": 7, "briseisencod": 3, "british": 24, "britt": 49, "britta": 28, "brittani": 5, "brittl": 24, "broaden": 25, "broader": [22, 24], "broadli": [8, 13, 19, 39, 51], "broekhui": 49, "broken": [2, 24, 34, 49], "brook": 14, "brotli": [1, 21], "brought": [24, 31], "browaei": 25, "browaeys_2020": 25, "brown": [3, 24, 38], "browser": 23, "bruce": 30, "bruggen": [50, 51], "brumhard": [17, 26], "brunner": 29, "bruno": 7, "bryan": [2, 7], "bryce": 2, "bryson": 7, "br\u00fcning": 23, "bsgenom": [8, 11], "bsgenome_1": 8, "bss20": 25, "btaa611": 19, "btaa739": 4, "btaa777": 23, "btab036": 25, "btab164": 41, "btac775": 25, "btla": 27, "btp616": 14, "btw631": 2, "bty175": 47, "bty191": 23, "bty888": 23, "btz444": 17, "btz625": 7, "btz698": 23, "bubbl": 23, "buchanan": 7, "buchwalt": 9, "budd": 49, "budget": 24, "budin": 15, "buencolor": 8, "buencolors_0": 8, "buenrostro": [8, 11, 38, 50], "buenrostrolab": 8, "buettner": 50, "buffer": [2, 24], "buffoni": 38, "bug": [1, 4, 19], "bugarin": 48, "buhlmann": 15, "bui": [5, 7, 14, 50], "build": [3, 8, 13, 18, 19, 22, 38, 44, 49], "build_nhood_graph": 13, "built": [0, 7, 10, 23, 27, 49], "bulk": [7, 9, 14, 18, 24, 25, 39], "bulk_sc_gen": 17, "bulkahb17": 17, "bulkat21": 17, "bulkbvw": 17, "bulkdata": 17, "bulkdcw19": 17, "bulkkkb": 17, "bulkmlx": 17, "bulkmmo": 17, "bulkno": 17, "bulknsl": 17, "bulksch10": 17, "bulksmal": 17, "bulksog13": 17, "bulkssrp": 17, "bulkzbsa19": 17, "bull": 49, "bulletin": 33, "bunch": 27, "bundl": 24, "burden": 13, "burdin": 17, "burgin": [13, 22], "burk": 24, "burkett": 8, "burkhardt": [7, 11, 13, 27, 28, 34, 48], "burmedi": 25, "burn": [13, 23], "burnin": 8, "burton": 2, "burtscher": 51, "busbi": 26, "bushra": 49, "busskamp": 5, "bustool": 23, "butler": [5, 7, 14, 16, 19, 27, 28], "butt": 17, "bx": 17, "byrn": [14, 15, 16, 25, 50], "bystand": 1, "bystrykh": 49, "byunghe": 26, "byungjin": 50, "b\u00fcttner": 5, "c": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 33, 36, 37, 45, 47, 48, 49, 50, 51], "c0": 37, "c1": 37, "c15orf39": 8, "c2": [15, 37], "c2l": 36, "c4orf50": 12, "c5": 15, "c5ar1": 27, "c7": 15, "c_": [36, 38], "c_call": [1, 2], "c_call_b_vdj": 1, "c_call_b_vj": 1, "c_call_vdj": 1, "c_call_vj": 1, "c_gene": 2, "c_i": 38, "ca": [26, 49], "ca06": 2, "caagtdyeqyf": 4, "caaqgssmetqyf": 4, "caartvntgelff": 4, "caavqgpsyeqyf": 4, "caawddslsasyvf": 2, "cabello": 25, "cabl": 36, "cabrera": 49, "cacagtaagtgtccat": 3, "cacer": [7, 11, 27, 28, 34, 48], "cacgagedtgelff": 4, "cacgkgggslrytf": 4, "cacgpggpstdtqyf": 4, "cachem_1": 8, "cacpstsgintgelff": 4, "cacrglagyeqyf": 4, "cadarsswdtqyf": 4, "cadm1": [5, 12], "caeagrddkiif": 4, "caenorhabd": 49, "caggsqwevkldyw": 3, "cagtaaccaggaatcg": 3, "cahil": 49, "cai": [7, 37, 49], "cairo": [8, 11], "cairo_1": 8, "caisasgggssgntiyf": 4, "caitlin": [25, 50], "caiyun": 5, "cakawigldseiyydyiwgsyridfdyw": 2, "calcium": 25, "calcnormfactor": [14, 15], "calcsoupprofil": 34, "calcul": [1, 3, 4, 5, 6, 8, 10, 13, 14, 17, 19, 21, 25, 26, 27, 28, 31, 33, 34, 37, 38, 40, 41, 50, 51], "calculate_adj_matrix": 37, "calculate_qc_metr": [11, 19, 21, 34, 48], "calculate_threshold": 1, "calculatecpm": 21, "caleb": [8, 9, 11, 48, 49, 50], "caleblareau": 8, "calero": [1, 2], "calibr": 18, "california": 50, "call": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 15, 17, 18, 19, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 37, 40, 47, 48, 49, 50, 51], "callan": 1, "callback": [14, 27, 28, 32, 33, 34], "callori": 7, "callr_3": 8, "cam": 50, "camargo": 49, "cambridg": [1, 2], "came": [14, 49], "camera": [2, 15], "cameron": 25, "camil": 14, "camillo": 25, "camk2n1": 41, "camp": 23, "campbel": [5, 14, 34], "campo": 5, "can": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "cancan": 7, "cancer": [13, 15, 16, 30], "candid": [1, 8, 26, 40], "caneda": 24, "cang": [25, 39, 41], "cannoodt": [7, 11, 27, 28, 34, 48, 50], "cannot": [2, 4, 5, 7, 8, 10, 14, 16, 19, 21, 26, 30, 49, 51], "canon": 25, "canptrpyssswwyfdyw": 2, "canzar": 2, "cao": [7, 13, 16, 23, 27], "cap": 23, "capabl": [3, 16, 19, 23, 24, 25, 26, 49], "capac": [2, 13, 24, 49], "capit": [26, 42], "cappuccio": 14, "captum": 5, "captur": [2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 28, 30, 31, 33, 34, 36, 37, 38, 39, 43, 47, 48, 49, 50, 51], "caputo": 7, "carci": 13, "card": 42, "cardin": 23, "cardiomyocyt": 36, "cardnrvyydfwsgypdyw": 2, "cardrrsaycsggscwggdwfdpw": 2, "care": [3, 4, 5, 7, 11, 14, 36, 51], "carefulli": [4, 15, 23, 33, 49], "caregmvyvdyw": 3, "carei": [17, 19, 22, 50], "caret_6": 25, "carl": [14, 23], "carli": 7, "carlo": [5, 7, 11, 16, 23, 27, 49, 50], "carlson": [19, 22, 49], "carmen": [8, 9, 15, 25, 26], "carntgnqfyf": 4, "carolin": [24, 50], "carolina": 51, "carpp": 22, "carprsliaaagafdiw": 3, "carr": 23, "carri": [2, 4, 15, 18, 23, 24, 25, 49], "carrier": 24, "carrol": 24, "carr\u00e9": 17, "carsten": 24, "carswel": [2, 24], "cartridg": 17, "carvalho": [19, 22], "cas13": 16, "cas9": [16, 49], "cascad": 51, "case": [1, 2, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 19, 21, 22, 23, 24, 26, 27, 30, 31, 32, 34, 36, 37, 38, 47, 49, 50, 51], "caseevtmvrgvmfpygmdvw": 3, "casei": 23, "casp8": 8, "casp9": 3, "casper": [14, 24], "casrpsglntdtqyf": 4, "cassargasgertdtqyf": 1, "cassdsstdtqyf": 4, "cassett": 49, "cassiopeiasolv": 49, "cassiopeiatre": 49, "cassipoeia": 49, "casslsgnsyeqyf": 4, "cassqtggqpqhf": 4, "cassqtsggtdtqyf": 4, "cassyggyneqff": 4, "cast": [1, 2], "castelo": [15, 50, 51], "castro": 26, "cat": [5, 13, 14, 25], "catalina": [7, 14], "catalog": [26, 30], "catalogu": 4, "catalyt": 18, "catccaccaacgcacc": 3, "catch": 16, "catct": 49, "categor": [1, 3, 4, 5, 7, 14, 16, 19, 23, 27, 34, 36, 37, 38, 49], "categori": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 19, 23, 25, 36, 37, 39], "categorical_covariate_kei": [7, 27, 28, 36], "categories_dset": 7, "catgagttcagcagag": 28, "catgt": 49, "catherin": [5, 7, 14, 19, 25, 27, 28, 29, 48], "catia": 24, "catools_1": [8, 25], "catqnpgyssswddrgafdiw": 3, "caus": [1, 3, 5, 7, 13, 16, 18, 21, 23, 24, 25, 27, 28, 41, 51], "caution": [3, 4, 5, 6, 16, 25, 48, 51], "cautiou": 3, "caval": 49, "cave": 14, "caveat": [1, 21, 23, 24, 49], "cavgapgddkiif": 4, "cavin": [5, 7], "cavkrgnnarlmf": 4, "cavnspggyqkvtf": 4, "cavselgseklvf": 4, "cavspfnagggnkltf": 4, "cavsvvrnnnarlmf": 1, "cax": [7, 36], "cb": 23, "cb_permit_list": 23, "cbg": 49, "cbl": 15, "cc_aa_ident": 1, "ccattgtgtagacaaa": 7, "cccgg": 49, "ccd": 2, "ccgaa": 49, "ccgttactcaatgtgc": 7, "ccitgb1": 12, "ccl5": [5, 8, 12, 25], "ccm": [4, 49], "ccr4": 27, "ccr6": 27, "ccr7": [5, 8, 12], "cd": [3, 4, 23], "cd101": [12, 45], "cd103": [12, 27, 45], "cd105": [12, 45], "cd112": [12, 45], "cd11b": [12, 27, 43], "cd11c": [12, 27, 43, 45], "cd122": 27, "cd123": 45, "cd124": 27, "cd127": [12, 27], "cd13": [12, 27], "cd137": 27, "cd14": [5, 7, 12, 14, 16, 25, 43, 44, 45, 46], "cd146": 45, "cd14_monocyt": 14, "cd14_monocytes_1": 17, "cd14_monocytes_2": 17, "cd14_monocytes_3": 17, "cd152": [27, 45], "cd154": [27, 45], "cd155": [12, 45], "cd158b": 12, "cd158e1": 12, "cd16": [5, 7, 12, 15, 26, 27, 43, 44, 45], "cd160": 12, "cd161": [12, 27, 45], "cd162": 45, "cd16_monocyt": 17, "cd172a": 12, "cd185": [27, 45], "cd19": [43, 45, 46], "cd194": [12, 27, 45], "cd195": 45, "cd196": [27, 45], "cd1c": 12, "cd20": [5, 7, 12, 27, 45], "cd21": 27, "cd223": 45, "cd224": 45, "cd226": 12, "cd23": [27, 45], "cd24": [5, 12], "cd247": [5, 12, 25], "cd25": [12, 27, 45], "cd26": [12, 27], "cd268": [12, 27], "cd27": 45, "cd270": 45, "cd272": 27, "cd274": 45, "cd278": 27, "cd279": [12, 45], "cd29": 27, "cd3": [27, 43, 44, 45, 46], "cd300lf": 8, "cd303": [12, 27], "cd304": [12, 27], "cd31": 45, "cd314": [12, 27], "cd319": [12, 27], "cd32": [43, 45], "cd328": 45, "cd33": 45, "cd335": [12, 27, 45], "cd34": [5, 12, 17, 38], "cd35": [12, 27], "cd352": [12, 27], "cd366": 16, "cd38": [5, 12, 14, 43], "cd39": [12, 27], "cd3d": 25, "cd3e": 8, "cd3g": [25, 27], "cd4": [1, 2, 4, 5, 7, 12, 14, 25, 26, 43, 44, 45], "cd40": [12, 45], "cd40lg": 27, "cd44": [25, 45], "cd45": 43, "cd45ra": [12, 45], "cd45ro": [12, 45], "cd47": [25, 45], "cd48": [25, 45], "cd49a": 27, "cd49f": [12, 27, 45], "cd4_t_cell": 14, "cd4_t_cells_1": 17, "cd4_t_cells_2": 17, "cd4_t_cells_3": 17, "cd4t_adata": 16, "cd4t_stim": 16, "cd5": 45, "cd52": 45, "cd54": 27, "cd56": [12, 27, 43, 45], "cd57": 12, "cd62l": [27, 45], "cd62p": 12, "cd63": [12, 25], "cd69": [5, 12, 45], "cd7": 45, "cd71": [12, 27], "cd73": 27, "cd74": 12, "cd79b": [5, 12, 27], "cd8": [1, 2, 3, 4, 5, 7, 12, 15, 16, 25, 27, 43, 44, 45], "cd81": 12, "cd82": [12, 45], "cd85j": [12, 27, 45], "cd86": [8, 12, 16, 45], "cd88": [12, 27, 45], "cd8_t_cell": [14, 17], "cd8a": [5, 12, 25, 27], "cd8b": [5, 12], "cd9": 12, "cd94": [12, 27, 45], "cd95": 27, "cdc1": [5, 12], "cdc2": [5, 7, 12], "cdk6": [5, 12], "cdmk13": 1, "cdna": [2, 18, 23, 24], "cdnvh": 1, "cdr": [2, 4], "cdr1": 2, "cdr2": [2, 14], "cdr3": [1, 2, 3, 4], "cdr3_a_aa": 4, "cdr3_b_aa": 4, "cdr3_col": 1, "cdr3_nt": 2, "cdr3b_trim": 4, "cdr3beta": 4, "cdr3\u03b1": [3, 4], "cdr3\u03b2": [3, 4], "cdrh3": 4, "cdrl3": 4, "ce": [7, 11, 27, 28, 34, 48], "ceccarelli": 17, "cecilia": 25, "cedric": [23, 37], "ceglia": 5, "cel": [5, 17, 23, 24, 34], "celina": 15, "cell": [0, 1, 3, 4, 5, 8, 10, 12, 18, 21, 26, 27, 28, 31, 32, 33, 37, 40, 41, 43, 44, 47, 48, 49, 50, 51], "cell2cel": 25, "cell2loc": [37, 38, 40, 41], "cell_": [19, 21], "cell_0": [19, 21], "cell_1": [19, 21], "cell_10": 19, "cell_2": [19, 21], "cell_3": [19, 21], "cell_4": [19, 21], "cell_5": [19, 21], "cell_6": 19, "cell_7": 19, "cell_8": 19, "cell_9": 19, "cell_95": 19, "cell_96": 19, "cell_97": 19, "cell_98": [19, 21], "cell_99": [19, 21], "cell_count_cutoff": 36, "cell_cycle_conserv": [7, 28], "cell_df": 4, "cell_id": [1, 2, 4], "cell_ident": 14, "cell_identity_kei": 14, "cell_label": 13, "cell_label_color": 13, "cell_level": 13, "cell_meta": 49, "cell_percentage_cutoff2": 36, "cell_rang": [7, 17], "cell_state_df": 36, "cell_subsets_r": 17, "cell_typ": [5, 7, 8, 14, 15, 16, 19, 25, 26, 27, 28, 36, 38], "cell_type_col": 16, "cell_type_color": [7, 14, 15, 25, 27, 28, 36], "cell_type_identifi": 13, "cell_type_l1": [27, 28], "cell_type_l2": [27, 28], "cell_type_l3": [27, 28], "cell_type_origin": 36, "cell_type_original_color": 36, "cell_types_to_check": 5, "cellannot": 8, "cellar": 13, "cellassign": 5, "cellbc": 49, "cellbox": 16, "cellcal": 25, "cellcel": 25, "cellchat": 25, "cellchat_pv": 25, "cellfract": 17, "cellgeni": 21, "cellid": [2, 26, 38], "cellink": 25, "cellknn": 8, "cellmark": 15, "cellnam": 17, "cellphone_pv": 25, "cellphonedb": 25, "cellphonedbv2": 25, "cellrang": [3, 4, 11, 23, 34], "cellranger_out": 11, "cellrank": 51, "celltyp": [14, 21], "celltype_color": 21, "celltype_condit": 15, "celltype_to_predict": 16, "celltypeid_new": 38, "celltypenumcutoff": 17, "celltypist": 5, "celltypist_cell_label_coars": 5, "celltypist_cell_label_fin": 5, "celltypist_conf_score_coars": 5, "celltypist_conf_score_fin": 5, "cellular": [5, 6, 11, 13, 15, 16, 17, 18, 19, 23, 24, 25, 26, 30, 33, 34, 38, 40, 48, 49, 50, 51], "celrep": [17, 23], "center": [1, 2, 3, 5, 8, 11, 14, 16, 17, 37, 42], "cento": [27, 28], "centr": [1, 2], "central": [3, 7, 18, 23], "centroid": [3, 44], "centuri": 49, "cerciat": 51, "cerebellar": 24, "cerebellum": 17, "certain": [2, 3, 5, 8, 11, 18, 19, 23, 25, 26, 34, 37, 48, 49], "certainli": 22, "certainti": 5, "certifi": [1, 21], "cesaro": 25, "cesgratitmivvtdldyw": 2, "cetin": 24, "cf": 37, "cffi": [1, 7, 15, 21, 25], "cg": 36, "cg22": 27, "cgata": 49, "cgccg": 49, "cggag": 49, "cggaggatat": 49, "cgttaacaggtgtcca": 7, "cgtwdsslsawvf": 2, "cha": 25, "chad": 24, "chaffin": 7, "chaichoompu": [7, 28], "chain": [1, 2, 3, 4, 15, 17, 18, 24, 49, 50], "chain_pair": [1, 2, 4], "chain_qc": 2, "chain_statu": 1, "chaisson": 23, "chakraborti": 43, "challeng": [5, 7, 9, 11, 13, 14, 16, 17, 21, 23, 24, 25, 28, 29, 30, 33, 34, 39, 47, 48, 49, 50, 51], "chamber": 24, "chan": [5, 26, 49], "chang": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 28, 29, 33, 34, 36, 37, 38, 39, 41, 46, 47, 49, 50, 51], "changeo": 1, "changeo_clone_id": 1, "changeo_clone_id_s": 1, "changeo_clone_id_size_max_50": 1, "channel": [5, 6, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "chantip": [17, 26], "chao": [23, 26], "chaohan": 31, "chapman": 40, "chapter": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 19, 21, 22, 23, 24, 25, 26, 28, 29, 30, 33, 34, 41, 43, 44, 45, 47, 48, 49], "charact": [10, 18, 21, 49], "character": [1, 4, 9, 13, 14, 15, 16, 19, 23, 24, 25, 39, 49, 50], "character_matrix": 49, "character_matrix_filt": 49, "characterist": [2, 3, 11, 13, 23, 24, 25, 37, 50, 51], "chardet": 1, "chardon": 49, "charg": [2, 26], "chariti": [14, 15], "charl": [5, 38, 49], "charlott": [4, 5, 14, 17, 19, 22, 23, 24, 25, 26, 27, 28, 51], "charset_norm": [1, 21], "chart": 7, "chase": [3, 4, 5, 7, 49, 50], "chattopadhyai": [9, 16, 47, 48, 50], "chatzidimitri": 23, "chaudhuri": 17, "chauv": 23, "chauvet": 49, "chavez": 5, "chazarra": 7, "cheaper": [18, 24], "cheapest": 24, "check": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "check_graph": 27, "check_random_st": 15, "checkansw": 42, "checkmate_2": 25, "checkpoint": [16, 27, 48], "checksum": 19, "chee": 37, "cheimona": 1, "chemic": [3, 16, 18, 24, 49], "chemistri": [23, 24, 49], "chen": [3, 5, 7, 11, 15, 16, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 48, 49, 50, 51], "chenchen": 26, "chenfei": 25, "cheng": [7, 13, 17, 26, 36, 37, 38, 49], "chengzh": 5, "chenl": [7, 49], "chenqu": 50, "cheol": 1, "chernyshev": 1, "chevrier": 7, "chevron": 23, "chew": 8, "chex": 7, "chichelnitskii": [5, 7, 50], "chih": 17, "child": 13, "chimenti": 14, "chiou": 7, "chip": [2, 8, 23, 24], "chisq": 14, "chisto": 5, "chlo": [7, 24, 49, 50], "chloe": [7, 11, 14, 27, 28, 34, 48], "chlo\u00e9": 17, "cho": [2, 26, 49], "choi": [25, 49], "choic": [7, 9, 13, 15, 16, 19, 23, 24, 25, 31, 32, 42, 49, 50], "choli": 49, "chong": 5, "choos": [1, 3, 4, 5, 11, 23, 25, 29, 32, 33, 37, 49], "chose": [11, 14], "chosen": [1, 2, 4, 5, 13, 15, 16, 23, 32, 34, 48, 50, 51], "choudhari": 27, "choudhri": 9, "chow": 49, "chozen_isoform": 38, "chr": [8, 25], "chr1": [10, 11], "chr10": 11, "chr11": 11, "chr12": 11, "chr13": 11, "chr14": 11, "chr15": 11, "chr16": 11, "chr17": 11, "chr18": 11, "chr19": 11, "chr2": 11, "chr20": 11, "chr21": 11, "chr22": 11, "chr3": 11, "chr4": 11, "chr5": 11, "chr6": 11, "chr7": 11, "chr8": 11, "chr9": 11, "chri": [16, 23, 24, 30, 49], "christiaen": [8, 9], "christian": [5, 13, 15, 17, 24, 25, 26, 40], "christiansen": [16, 23], "christin": [5, 7, 17, 24, 26, 50], "christina": [3, 4, 19, 23, 37, 40, 41], "christlei": 4, "christof": [17, 24, 26], "christoph": [3, 5, 7, 9, 10, 11, 13, 15, 16, 17, 22, 23, 24, 26, 27, 28, 34, 36, 47, 48, 49, 50], "chrm": 11, "chrom_assai": 10, "chromatin": [7, 9, 11, 18, 19, 26, 28, 30, 39, 48, 50], "chromatinassai": 10, "chromatograph": 2, "chromatographi": [2, 24], "chromium": [9, 23, 24, 49], "chromiumv3": 23, "chromosom": [8, 10, 11, 23, 24], "chromvar": [8, 11], "chromvar_1": 8, "chronist": 4, "chrx": 11, "chry": 11, "chrysa": 2, "chuan": [5, 7, 50], "chuanchuan": 4, "chuang": [15, 36, 38], "chuanyu": 37, "chun": [15, 23], "chuner": 49, "chung": [5, 7, 50], "chunk": [21, 23], "chunlin": 3, "chunquan": 26, "chunyu": 15, "church": 49, "ch\u00e9dotal": 25, "ci": [8, 9, 26], "ciara": 5, "cibersortx": 17, "ciccon": 7, "cicek": 11, "cigar": [23, 49], "circl": [1, 13], "circle_diamet": 36, "circlize_0": [8, 25], "circular": 36, "circumv": [14, 51], "ciro": [5, 7, 43, 44, 45, 46, 47, 48, 50, 51], "cisassign": 8, "ciscorr": 8, "cistarget": 26, "cistop": 9, "cistopic_0": 8, "cistopic_bkp_path": 8, "cistopicobject": 8, "cite": [4, 16, 19, 25, 27, 30, 47, 48, 50], "cite_batch_correct": 44, "cite_dimensionality_reduct": 45, "cite_doublet_removal_xdbt": [44, 45, 46], "cite_filt": [46, 48], "cite_norm": [46, 47], "cite_preprocess": 43, "cite_quality_control": [47, 48], "cite_query_batch": 27, "cite_raw": [47, 48], "cite_reference_batch": 27, "cite_xdbt": [44, 45], "cittaro": 13, "ciup": 1, "ciyu": 16, "ckch21": 1, "cl_annot": 5, "clade": 49, "clade_color": 49, "cladogram": 49, "clair": [4, 49, 50], "clang": [7, 15, 21], "clarif": 30, "clariti": 18, "clark": [5, 7, 15, 50], "clash": 43, "class": [1, 4, 5, 7, 10, 11, 13, 14, 16, 19, 21, 23, 27, 28, 34, 42, 49], "class_7": 25, "classic": [5, 14, 36, 49, 50, 51], "classif": [5, 13, 15, 34, 50], "classifi": [4, 13, 16, 18, 23, 25, 43, 46, 49], "clatworthi": 5, "claudia": [14, 16, 17, 26], "clean": [14, 28], "cleanli": 49, "clear": [1, 3, 5, 7, 13, 14, 22, 23, 34, 36, 37, 44, 49, 51], "clearer": 4, "cleari": [16, 49], "clearli": [3, 6, 7, 13, 14, 15, 16], "cleavag": [1, 9], "clec10a": [5, 12], "clec12a": 5, "clec4c": 27, "clec9a": [5, 12], "clecl1": 15, "clemen": [3, 4], "clemenc": 49, "clement": 11, "clementin": 5, "clever": 50, "cli": [7, 21, 50], "cli_3": [8, 25, 27, 28], "click": [7, 15, 21, 25], "clinic": [17, 48], "clip": 23, "clip_at": 1, "clisi": [7, 28], "clivio": 7, "clonal": [2, 3, 4, 24, 49], "clonal_expans": 1, "clone": [1, 3, 4, 24, 49], "clone_annot": 3, "clone_df": 4, "clone_fil": 3, "clone_id": 3, "clone_kei": 1, "clone_network": 1, "clone_s": 1, "clones_fil": 3, "clonotyp": [3, 4], "clonotype10": 2, "clonotype10_consensus_1": 2, "clonotype11": 2, "clonotype11_consensus_1": 2, "clonotype9": 2, "clonotype9_consensus_1": 2, "clonotype9_consensus_2": 2, "clonotype_network": [1, 4], "clonotypes_top10": 3, "close": [1, 4, 5, 8, 9, 11, 12, 13, 14, 15, 16, 19, 23, 24, 26, 28, 32, 36, 37, 38, 40, 41, 48, 49], "closer": [1, 11, 25], "closest": [11, 23, 49], "cloudpickl": 1, "clp": 50, "clr": [16, 27, 47], "clue_0": [8, 25], "clust_col": 36, "clust_label": 36, "cluster": [1, 2, 4, 7, 8, 9, 10, 11, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 49, 50, 51], "cluster_2": [8, 25, 27, 28], "cluster_co_occurr": 40, "cluster_color": 37, "cluster_interact": 40, "cluster_kei": [13, 40], "cluster_labels_r": 17, "cluster_nhood_enrich": 40, "cluster_numb": 3, "clustergrid": [1, 26], "clustermap": [4, 26], "clusters_coars": 51, "clusters_coarse_color": 51, "clusters_color": [50, 51], "clusters_top10": 3, "clustifyr": 5, "cm": 7, "cm_nsbm_level_0": 13, "cm_nsbm_level_1": 13, "cm_nsbm_level_2": 13, "cm_nsbm_level_3": 13, "cm_nsbm_level_4": 13, "cm_nsbm_level_5": 13, "cmap": [5, 7, 11, 15, 25, 26, 36], "cmd_bcr_embed": 3, "cmd_beniss": 3, "cmd_conga": 3, "cmd_conga_pp": 3, "cmd_ergo": 4, "cmd_tcrmatch": 4, "cmd_tessa": 3, "cmp": 5, "cmv": 4, "cner_1": 8, "cnt": 2, "co": [0, 4, 16, 17, 25, 26, 38, 48], "co_occurr": 40, "coach": 9, "coars": [5, 6, 33], "coarser": [5, 6], "coarsest": 23, "coat": [18, 24], "cobll1": [5, 12], "cobo": 17, "cocain": 16, "cocktail": 2, "coda": 13, "code": [1, 3, 4, 5, 7, 9, 10, 11, 13, 14, 18, 21, 22, 23, 24, 28, 38, 49, 50, 51], "codebas": 49, "codetool": [7, 21], "codetools_0": [8, 25, 27, 28], "codex": 39, "codi": 23, "codon": [1, 2, 18, 24], "coef": 14, "coeffici": [8, 13, 14, 16, 32], "cog": 5, "coher": 49, "cohort": 7, "coi": 17, "coin": 50, "coisb": [25, 50], "col": [4, 14], "col4a1": 38, "col4a4": [5, 12], "col_attribut": 26, "col_index": 21, "col_linkag": 4, "colab": 3, "coldata": [7, 8, 14, 17, 21, 34], "cole": [5, 7, 23, 44, 49], "coleman": [37, 41], "coli": 26, "colin": [2, 23], "collabor": [15, 21, 30], "collado": 26, "collaps": 23, "collat": [7, 21, 23], "colleagu": [24, 49], "collect": [2, 3, 4, 9, 13, 17, 19, 23, 24, 25, 26, 36, 41, 42, 51], "collection_dai": 2, "collier": 24, "collin": [2, 5, 7, 23, 50], "collis": 23, "colnam": [7, 8, 14, 15, 21, 25, 34], "colom": [7, 28], "color": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 31, 32, 34, 36, 37, 38, 41, 42, 43, 44, 45, 46, 49, 50, 51], "color_map": [33, 36, 50], "color_schem": 1, "colorama": [1, 7, 15, 21, 25], "colorbar_posit": 36, "colorbar_shap": 36, "colormap": [5, 7, 25, 36], "colorpalett": 8, "colorspac": [7, 21], "colorspace_2": [8, 25, 27, 28], "colour": [7, 8, 25], "colourmap": 38, "colpair": 21, "colq": 8, "colsum": 14, "column": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 32, 34, 36, 41, 49, 51], "column_cdr3a": 3, "column_cdr3b": 3, "column_names_gp": 8, "columnam": [10, 21], "com": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 43, 44, 45, 46, 47, 48, 49], "combat": 7, "combin": [1, 2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 17, 18, 23, 24, 27, 28, 31, 36, 37, 40, 48], "combinatori": [2, 16, 49], "combiz": [19, 29], "come": [1, 5, 7, 14, 15, 16, 19, 21, 24, 25, 36, 49], "comet": 3, "comet_workspac": 3, "comfort": [16, 21], "comm": 21, "comma": [2, 23], "command": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "comment": [3, 30, 50], "commerci": [9, 23, 24, 36, 39], "commod": 1, "common": [1, 2, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 27, 28, 34, 36, 39, 49, 50, 51], "common_idx": [27, 28], "commonli": [3, 4, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 33, 45], "commun": [0, 1, 2, 3, 5, 6, 9, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 29, 30, 31, 34, 36, 37, 39, 41, 47, 49, 50, 51], "comorbid": 17, "compact": [1, 9, 23], "compait82": 13, "compani": 24, "compar": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 31, 33, 34, 36, 37, 38, 41, 48, 49, 50, 51], "comparison": [4, 5, 6, 8, 11, 13, 14, 17, 18, 22, 23, 24, 25, 26, 31, 33, 36, 38, 49], "compart": [1, 17, 26], "compartment": 24, "compat": [1, 2, 5, 13, 15, 16, 28], "compbah19": 13, "compbst": 13, "compbuttneromul": 13, "compclo": 13, "compdht": 13, "compepgmfbarcelov03": 13, "compet": [1, 21], "competit": [1, 7, 15, 27], "compfrm": 13, "compgmpge17": 13, "comphbr": 13, "compil": [5, 26], "compiler_4": [8, 15, 25, 27, 28], "complement": [2, 22, 23, 43, 48], "complementari": [2, 8, 18, 22, 24, 25], "complet": [2, 3, 4, 5, 7, 13, 16, 17, 18, 19, 21, 24, 27, 29, 33, 44, 49], "complex": [1, 2, 4, 9, 13, 14, 16, 18, 19, 21, 23, 24, 25, 30, 31, 33, 36, 41, 43, 49], "complexheatmap": [8, 11, 25], "complexheatmap_2": [8, 25], "compliant": 4, "complic": [1, 5, 23], "complimentari": 25, "complp20": 13, "complrm17": 13, "compmgc21": 13, "compocm21": 13, "compon": [2, 5, 6, 9, 14, 16, 17, 18, 19, 23, 25, 31, 33, 34, 39, 41, 42, 45, 49, 50], "compos": [1, 7, 16, 23, 24, 25, 36], "composit": [1, 3, 5, 7, 17, 23, 24, 34, 36, 40, 41, 47, 49], "composition": 13, "compound": [16, 49], "comprehens": [7, 9, 14, 15, 17, 22, 23, 24, 25, 26, 28, 30], "compress": [3, 7, 13, 18, 19, 21], "compris": [16, 19], "compro10": 13, "compromis": [15, 23], "compssh": 13, "comput": [0, 1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 15, 16, 17, 18, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 44, 45, 50, 51], "computation": [1, 4, 11, 15, 19, 23, 24, 26, 31, 34, 38, 49], "compute_empirical_indel_prior": 49, "compute_expansion_pvalu": 49, "compute_expected_per_cell_typ": 36, "compute_motif": 1, "compute_pal_motif": 3, "compute_percent_indel": 49, "compute_percent_uncut": 49, "computesumfactor": 33, "compzjl": 13, "concat": [5, 7, 15, 27, 28, 38, 48], "concat_batch": 27, "concaten": [5, 7, 14, 15, 16, 19, 27, 28, 48], "concentr": [13, 25, 48], "concept": [1, 9, 17, 18, 19, 21, 23, 24, 25, 30, 33, 36, 37, 49], "conceptu": [16, 23, 25, 26], "concern": [15, 16, 23, 24, 25, 49], "conchola": 5, "concis": 23, "conclud": [15, 50], "conclus": [13, 14, 18, 23, 24, 51], "concord": [15, 16, 25], "cond": [5, 40], "conda": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "conda_prefix": 3, "conda_subdir": 23, "condit": [1, 2, 4, 7, 14, 15, 16, 17, 24, 25, 27, 28, 29, 30, 40, 46, 49], "condition_col": 25, "condition_color": [13, 15, 25], "condition_ind": 15, "condition_kei": [14, 16], "condition_label": 16, "conditioncontrol": 13, "conditionsalmonella": 13, "conditiont": 13, "conduct": [3, 4, 13, 14, 15, 16, 17, 19, 23, 24, 34, 36, 49], "conf_dict": 13, "conf_scor": 5, "confer": [7, 11, 27, 28, 34, 48, 49], "confid": [2, 4, 5, 13, 16, 21, 23, 24, 25, 26, 36, 49, 51], "config": 23, "configur": [2, 23], "configuration_valid": [28, 36], "configure_dataset": 27, "confin": 1, "confirm": [7, 17, 26, 40, 44], "conflict": 26, "confluenc": 49, "conform": [1, 8], "confound": [7, 13, 14, 16, 18, 33, 34], "confront": [14, 16], "confus": [21, 49], "conga_clone_fil": 3, "conga_gex": 3, "conga_results_summari": 3, "conga_tcr": 3, "conjug": [2, 48], "conjunct": 25, "conlon": 7, "connect": [2, 3, 4, 5, 6, 7, 13, 15, 18, 19, 21, 23, 25, 26, 27, 28, 36, 37, 38, 40, 43, 44, 45, 49, 50, 51], "connectionplot": 3, "connectom": 25, "connor": 1, "conor": 7, "conquer": 49, "conrad": [11, 17, 24, 26, 40], "consecut": 50, "consensu": [2, 5, 14, 41], "consensus_count": [1, 2], "consequ": [1, 8, 15, 23, 25, 38, 49, 50, 51], "conserv": [1, 4, 7, 13, 23, 28], "consid": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 17, 19, 21, 23, 26, 34, 36, 37, 48, 49, 50, 51], "consider": [1, 2, 3, 11, 14, 23, 26, 49], "consist": [1, 2, 5, 6, 7, 13, 15, 17, 18, 19, 23, 24, 25, 26, 27, 37, 38, 40, 41, 48, 49, 51], "consol": [1, 11, 15, 17, 21], "consortia": 26, "consortium": [7, 18], "constant": [1, 4, 13, 18, 23, 32, 36, 51], "constantin": [29, 33], "constantli": 30, "constitut": [23, 24], "constrain": [4, 22], "constraint": [4, 13, 23], "construct": [1, 3, 4, 5, 7, 13, 14, 19, 21, 23, 25, 28, 30, 31, 34, 36, 49], "consult": [23, 30], "consum": [17, 18, 23, 24, 26, 34, 49], "contact": [4, 25], "contain": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 38, 39, 40, 41, 43, 44, 45, 46, 48, 49, 51], "contamin": [14, 23, 33, 34], "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "contenti": 5, "context": [2, 4, 5, 7, 13, 15, 18, 19, 23, 25, 26, 28, 31, 38, 39, 41, 51], "contextlib2": 7, "contextu": [16, 25], "contig": [2, 3], "contig_id": [2, 3], "contigu": 23, "continou": 4, "continu": [4, 5, 7, 11, 13, 14, 15, 16, 17, 21, 23, 27, 34, 36, 48, 49, 50, 51], "continuous_covariate_kei": [7, 36], "continuum": [5, 36, 49], "contol": 47, "contract": 23, "contradictori": 5, "contrari": [1, 4, 18, 24, 25, 47, 48], "contrast": [7, 13, 14, 15, 23, 24, 25, 36, 50], "contrastingli": [50, 51], "contribut": [0, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 43, 44, 45, 46, 47, 48, 49, 50], "control": [3, 6, 7, 8, 9, 13, 14, 16, 17, 18, 19, 24, 25, 26, 29, 30, 33, 36, 47, 49], "control_mark": 38, "control_p1": 36, "convei": 23, "conveni": [3, 4, 5, 7, 16, 19, 21, 23, 26, 33, 37, 38, 41, 49], "convent": [4, 13, 21, 48, 49], "converg": [3, 7, 8, 23, 28, 36, 44], "convers": [1, 5, 7, 11, 13, 14, 18, 21, 28], "convert": [1, 2, 4, 7, 11, 13, 14, 17, 21, 23, 24, 25, 26, 28, 33, 38, 49], "convert_alleletable_to_character_matrix": 49, "convertformat": 21, "convolut": [37, 41], "coo_matrix": 28, "cookson": 17, "cooper": 2, "coordin": [5, 14, 19, 21, 23, 24, 25, 28, 36, 37, 38, 40, 41, 51], "copi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "cops5": 41, "corbett": 34, "corc": 9, "corcoran": 1, "core": [1, 4, 5, 7, 8, 11, 13, 16, 19, 21, 23, 25, 26, 27, 28, 36, 40, 41, 50, 51], "core_2": 27, "coreceptor": 4, "corefound": 21, "cork": 24, "corleon": 14, "corman": [17, 26], "cornal": 37, "corneliu": 24, "corner": [11, 14, 51], "coronaviru": [2, 4], "corpor": 31, "corr": [8, 38], "corr_method": 41, "corrada": [19, 22], "corrcoef": 17, "correct": [1, 2, 4, 5, 10, 11, 14, 15, 18, 21, 24, 26, 27, 28, 33, 36, 37, 41, 42, 45, 49], "correct_answ": 42, "correctli": [5, 7, 11, 17, 21, 23, 24, 36, 49], "correl": [1, 3, 8, 11, 13, 14, 15, 16, 17, 18, 19, 23, 25, 26, 38, 41, 48, 51], "correspond": [1, 3, 4, 5, 7, 9, 11, 13, 14, 16, 18, 19, 23, 24, 25, 27, 28, 30, 34, 37, 38, 45, 49, 50, 51], "correspondingli": [19, 23, 25], "corrupt": 23, "cortex": [16, 37, 40, 41], "cortex_1": 40, "cortic": 24, "coscia": 29, "cosin": [16, 27, 38, 51], "cospar": 49, "cost": [4, 13, 16, 21, 23, 24, 25, 31], "costa": [25, 36], "cotl1": [5, 12], "could": [0, 1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 19, 23, 24, 25, 26, 27, 28, 29, 34, 37, 38, 41, 43, 44, 46, 48, 49], "coulthard": 50, "count": [2, 3, 4, 5, 7, 8, 9, 14, 15, 16, 17, 18, 19, 21, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "count_cutoff_low": 11, "count_mat": 3, "count_nhood": 13, "counter": 4, "counts_df": 15, "counts_mat": 21, "counts_per_cell_aft": [17, 19], "coupl": [1, 2, 25, 34, 45, 51], "cours": [13, 19, 23, 25, 36], "courtin": [14, 16], "courtnei": [43, 49], "cov": [2, 3, 4, 7], "cov1": 4, "cov2": 4, "cov2_alpha": 4, "cov2_beta": 4, "cov2_g": 4, "cov2_gamma": 4, "cov2_wt": 4, "cov_abdab": 4, "cov_plot": 10, "covabdab": 4, "coval": 48, "covari": [7, 13, 14, 27, 28, 33, 34, 36, 41], "covariate_1": 13, "covariate_2": 13, "covariate_matrix": 13, "covariate_ob": 13, "cover": [3, 11, 19, 22, 23, 24, 25, 47], "coverag": [8, 10, 15, 22, 23, 24, 26, 27, 48], "coverageplot": 10, "covid": [1, 2, 3, 4, 15, 26], "cowplot": [7, 8, 21], "cowplot_1": [8, 25, 27, 28], "cowplot_mono": 8, "coxhead": 50, "cp": 15, "cpa6": 41, "cpdbv2": 25, "cpg": [9, 18, 24], "cpm": [15, 17, 21, 27, 28, 32, 33], "cpne7": 41, "cptp": 3, "cpu": [1, 5, 14, 15, 27, 28, 36, 38], "cr": 23, "cr1": 27, "cr1l": 8, "cr2": 27, "cracd": 12, "craft": 4, "craig": [14, 49], "cramer": [50, 51], "cran": [7, 21], "crash": 7, "crawford": [3, 4], "crayon_1": [8, 25, 27], "crc": 40, "crd3\u03b2": 4, "cre": 49, "creasei": 50, "creat": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "createassayobject": [27, 28], "createchromatinassai": 10, "createcistopicobject": 8, "creation": 23, "credenti": 2, "credibl": 13, "credible_effect": 13, "credit": 9, "crespo": 25, "cribb": 24, "crick": 24, "crinklaw": 4, "crisi": 2, "crispr": 49, "cristina": [14, 15, 16, 25], "criteria": [17, 49], "criterion": [8, 23], "critic": [1, 2, 14, 18, 23, 24, 25, 30, 49], "crmeth": 48, "cross": [2, 5, 16, 23, 25], "crosstab": 5, "crosstalk": 25, "crotti": 2, "crowd": 14, "crowlei": 47, "crtam": 5, "crucial": [5, 7, 9, 11, 15, 17, 23, 24, 25, 34], "csbj": [5, 39], "csc": 33, "cse63": 49, "csf3r": [5, 12], "csg": 49, "csl": 43, "csr": 25, "csr_matrix": [4, 5, 15, 19, 21, 33], "cst3": [5, 12, 19], "csv": [2, 3, 4, 11, 14, 21, 26, 36], "csvwtgegytf": 4, "csvytgtsayeqyf": 4, "cswlagqetqyf": 4, "ct": [5, 14, 19], "ct_count": 17, "ct_marker": 5, "ct_order": 5, "ct_to_keep": 17, "ctacctcagacaccgc": 7, "ctcccaatccattgga": [27, 28], "ctctg": 49, "ctctgaattc": 49, "ctggcaggtctcacgg": 28, "ctggtctcatccttgc": 3, "ctla4": 27, "ctor": 26, "ctrl": [14, 16, 25, 50], "ctrl_adata": 16, "ctrl_kei": 16, "ctsb": 8, "ctsrmdsnygytf": 4, "cttcaattcacgaatc": 7, "ctttgcgagctgccca": 3, "ctx": 26, "ctype": [7, 21], "cu459201": 19, "cuda": [3, 5, 27, 28, 36, 38], "cuda_visible_devic": [5, 27, 28, 36], "cui": [1, 25], "cultur": 24, "cumul": [23, 49], "cuoco": [7, 16], "cuomo": 7, "cupi": 28, "curat": [4, 5, 15], "curious": 1, "currcel": 17, "current": [3, 7, 8, 9, 10, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 29, 30, 41, 49, 50, 51], "curri": 49, "curti": 1, "curv": [1, 3, 8, 14, 16, 25, 26, 36, 50], "curve_layout": [1, 3], "custom": [4, 7, 19, 21, 26], "cut": [8, 11, 13, 14, 19, 24, 30, 41, 49], "cutoff": [4, 8, 13, 17, 34, 48], "cutrat": 49, "cv0902": [1, 4], "cvae": 7, "cvejic": 24, "cvfgfrgdtqyf": 4, "cvsrdkyeqyf": 4, "cvtegssyneqff": 4, "cvtglaentqyf": 4, "cvtretggggytf": 4, "cvtrysyeqyf": 4, "cvvrapwgsarqltf": 4, "cxcl10": 25, "cxcl11": 25, "cxcr5": 27, "cyb": 7, "cycif": 39, "cycl": [5, 6, 16, 18, 23, 24, 36, 51], "cycler": [1, 7, 15, 21, 25], "cyclic": 50, "cynomolgu": 1, "cynthia": 24, "cython_runtim": [1, 7, 15, 21, 25], "cyto": 6, "cytof": 17, "cytokin": [1, 2], "cytomegaloviru": 4, "cytometri": [1, 2, 6, 13, 17, 48], "cytoolz": 26, "cytoplasm": [18, 34], "cytosin": 18, "cytoskeleton": 24, "cytotalk": 25, "cytotox": 5, "d": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 33, 34, 38, 48, 49, 50, 51], "d0": 2, "d000": 2, "d018": 2, "d1": [4, 15, 26], "d100": 26, "d2": [7, 19], "d3": 8, "d419": 4, "d427": 4, "d721": 15, "d728": 15, "d93": 26, "d95f02": 7, "d_": 38, "d_c": 36, "d_call": 1, "d_call_b_vdj": 1, "d_call_vdj": 1, "d_cigar": 1, "d_gene": 2, "d_i": 36, "d_j": 38, "da": [7, 13, 14, 23, 50, 51], "da_nhood": 13, "dabrowska": 50, "dac": 16, "dafni": [8, 9], "dahlin": [6, 50], "dai": [13, 16, 17, 19, 37], "daigl": 24, "daines": 50, "dalmia": 17, "damag": [2, 16, 19, 23], "damian": 15, "damiano": 2, "damien": 28, "dan": [19, 22, 25, 49], "dana": [5, 7, 16, 23, 50, 51], "dandelion": 2, "dandelion_define_clones_heavi": 1, "danes": [7, 28], "dang": [17, 26], "danger": 13, "daniel": [1, 2, 3, 5, 7, 9, 11, 13, 15, 17, 22, 23, 24, 25, 26, 27, 28, 34, 43, 44, 45, 46, 47, 48, 49, 50], "daniela": [17, 26], "danielsson": 24, "danila": [19, 28, 48], "dann": [13, 36, 50], "danyi": 3, "darbi": [5, 14, 19, 27, 28], "darmani": 24, "darrel": 49, "darren": 24, "darwin13": [7, 15, 21], "dash": [3, 4, 21, 23, 51], "dask": 1, "dasom": 26, "data": [0, 4, 6, 8, 11, 12, 14, 18, 22, 24, 25, 29, 30, 31, 32, 33, 43], "data_3": [25, 27, 28], "data_dir": 51, "data_fil": 17, "data_load": 4, "data_mat": [11, 33, 34], "data_tod": 34, "databas": [2, 3, 15, 23, 25, 26], "datafram": [1, 2, 3, 4, 11, 13, 14, 15, 17, 21, 25, 26, 27, 28, 38, 41, 49], "dataload": 16, "datapoint": [39, 51], "dataset": [3, 4, 5, 6, 8, 9, 10, 13, 15, 17, 18, 19, 21, 23, 25, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 43, 45, 47, 48, 49, 50, 51], "dataset_id": [7, 27, 28], "dataset_nam": 27, "dataset_name_fin": 27, "datastructur": [1, 2, 3, 4], "datat": 14, "date": [1, 2, 4, 5, 7, 9, 21, 22, 26, 30], "date_of_sampl": 17, "dateutil": [1, 7, 15, 21, 25], "datset": 5, "daughter": 49, "daughton": 2, "daunt": 49, "dave": 50, "davi": [4, 5, 8, 9, 14, 15, 19, 22, 23, 24, 49], "david": [1, 3, 5, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 29, 36, 37, 40, 41, 49, 50, 51], "davidi": 38, "davidson": 5, "davislaboratori": 15, "dawei": [7, 50], "dawoud": 2, "day10": 13, "day3": 13, "day_color": 51, "daya": 5, "days_after_onset": 17, "days_from_onset": 2, "daza": [16, 49], "db": [1, 4], "db88": 4, "db_3": 8, "db_glob": 26, "db_name": 26, "dbdimitrov": 25, "dbi_1": 8, "dbl": [10, 25], "dbl_score": 11, "dc": [5, 15, 25, 50], "dc1": 5, "dc2": 5, "dc3": 5, "dclear": 49, "ddj09": 49, "ddl": 1, "de": [2, 5, 7, 11, 14, 15, 16, 17, 25, 26, 27, 28, 30, 31, 34, 48, 49, 50], "de_d": 25, "de_edger_": 14, "de_per_cell_typ": 14, "de_res_to_anndata": 14, "dea_leiden_2": 5, "dea_leiden_2_filt": 5, "dead": [19, 24], "deal": [1, 2, 7, 17, 19, 36, 47, 48], "dean": [4, 5, 7, 50], "death": [2, 16], "debat": 9, "debh95": 14, "debkvb": 14, "debnath": 40, "debora": 16, "deborah": 50, "debri": 23, "debug": 3, "debugpi": [1, 7, 15, 21, 25], "dec": [13, 14, 16, 17, 23, 24, 32, 44, 49], "decad": [0, 49], "decai": 37, "decemb": [5, 7, 9, 14, 23, 34, 39, 51], "decent": 15, "decid": [2, 7, 11, 13, 21, 48], "deciph": [3, 16, 24, 25, 39, 41, 50], "decis": [3, 4, 5, 16, 19, 28, 34, 50], "decitabin": 16, "declan": 51, "declar": [8, 26], "decod": [16, 27], "decoi": [17, 26], "decompos": [28, 36, 39, 41], "decomposit": [7, 19, 36], "decompress": [23, 37], "decompressionbombwarn": 37, "deconinck": [7, 11, 27, 28, 34, 48, 50], "decontamin": 34, "decontx": 34, "deconvolut": [23, 25, 33, 38, 39], "deconvolution_": 36, "deconvolution_book": 36, "deconvolv": [36, 39, 49], "deconvseq": 17, "decor": [1, 4, 7, 15, 21, 25], "decoupl": 25, "decovolut": 17, "decovolv": 17, "decreas": [7, 8, 11, 13, 15, 18, 23, 24, 31, 36, 51], "dedic": [19, 30, 34, 49], "dedrm": 14, "deduc": [13, 38], "deduct": 4, "dedupl": 23, "dee": 24, "deeg": [23, 24], "deem": [23, 24, 48], "deep": [3, 4, 5, 7, 9, 16, 17, 21, 23, 24, 27, 28, 38, 44, 49, 51], "deepen": 30, "deeper": [30, 38, 48], "def": [4, 13, 14, 15, 19, 25, 27, 34, 42, 48, 49], "default": [1, 3, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 19, 21, 23, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 41, 49, 51], "default_embed": 36, "default_gener": [19, 21], "default_rng": 19, "defaultassai": [10, 27, 28], "defb1": 14, "defect": 24, "defens": 1, "defin": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 15, 16, 17, 18, 19, 21, 23, 26, 29, 31, 34, 36, 40, 41, 47, 49, 50, 51], "define_clon": 1, "define_clonotyp": 3, "define_clonotype_clust": [1, 4], "defineclon": 1, "definit": [3, 4, 5, 7, 13, 23, 24, 25, 49], "defmi": 14, "deform": 24, "defusedxml": [1, 7, 21, 25], "deg": [3, 4, 14, 16, 25], "degrad": [18, 24, 34, 51], "degre": [2, 3, 4, 16, 23, 24, 33], "dehhan": 14, "dehtti17": 14, "dejse22": 14, "dejseyetermdnasrollahme16": 14, "dekst": 14, "del": [5, 7, 26, 28, 33, 34], "delahnemannkost": 14, "delai": [8, 48], "delayedarrai": [7, 21], "delayedarray_0": [8, 15, 27, 28], "delayedmatrixstats_1": 8, "deldir": [7, 21], "deldir_1": [25, 27, 28], "delet": [3, 4, 7, 18, 23, 28, 33, 34, 49], "delha14": 14, "delic": 30, "delimit": 18, "delin": 49, "deliveri": [24, 49], "delorei": [13, 22], "deloro": 28, "delt19": 14, "delta": [5, 16, 33, 49, 51], "delta_augur": 16, "delta_label": 37, "delv": [23, 49], "delzd": 14, "demand": 30, "demerdash": 51, "demix": 36, "demograph": 7, "demonstr": [1, 4, 7, 9, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 49], "dems22": 14, "demultid": 17, "demultiplex": [3, 18, 23], "den": [5, 7, 26], "dendrid": 43, "dendrit": [14, 16, 25], "dendritic_cel": 14, "dendrogram": [5, 13, 16, 26], "dendrogram_cell_typ": 26, "dendrogram_celltypist_cell_label_fin": 5, "dendrogram_leiden": 43, "dendrogram_leiden_2": 5, "dendrogram_mixscape_class": 16, "dene": [15, 26], "deng": [2, 7, 14, 15], "deni": [16, 36], "denis": 7, "denisenko": 25, "denni": [2, 17, 23], "denois": [19, 47], "denot": [5, 15, 16, 18, 25, 49], "dens": [5, 6, 19], "densiti": [4, 11, 13, 38], "density_prior": 38, "densli": 9, "dentate_gyru": 40, "dentro": 49, "denv2": 4, "deoxyribonucl": [18, 24], "depasqual": 23, "depend": [2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "depict": 9, "deplanck": 50, "deplet": [13, 16, 40], "deploi": 49, "deprec": [4, 5, 6, 7, 10, 13, 15, 19, 27, 28, 34], "deprecationwarn": [5, 7, 28], "deprez": 7, "depth": [5, 7, 11, 14, 22, 25, 33, 34, 36, 40, 49], "depth_first_traverse_nod": 49, "derek": 15, "deriv": [1, 2, 3, 4, 6, 8, 11, 13, 15, 16, 18, 19, 23, 25, 28, 48, 49], "derms10": 14, "derpw": 14, "desai": [5, 7, 50], "desc": 25, "descend": [23, 49], "descent": 31, "describ": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 31, 32, 33, 34, 36, 37, 38, 39, 44, 48, 49, 50, 51], "descript": [3, 4, 7, 18, 19, 23, 25], "deseq2": 14, "desgk": 14, "desig": 15, "design": [1, 2, 3, 4, 7, 13, 14, 16, 17, 21, 22, 23, 24, 25, 28, 30, 33, 41, 44, 45, 49], "desir": [4, 13, 15, 16, 21, 23, 24], "despit": [1, 2, 15, 16, 22, 23, 37], "desr18": 14, "dest": 21, "destroi": [50, 51], "destruct": [16, 51], "destvi": 36, "detail": [0, 1, 2, 3, 4, 5, 6, 7, 11, 14, 15, 16, 19, 21, 22, 23, 24, 25, 27, 28, 30, 34, 36, 38, 43, 44, 49, 51], "detect": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 18, 19, 21, 24, 26, 32, 36, 38, 41, 48, 49, 51], "detection_alpha": 36, "detector": 24, "determin": [2, 3, 4, 6, 7, 8, 9, 13, 14, 15, 17, 18, 23, 24, 25, 26, 28, 33, 36, 37, 49], "determinist": [38, 51], "detomaso": 15, "detrcp21": 14, "detriment": [2, 13], "detweil": [7, 11, 27, 28, 34, 48], "deutsch": [17, 26], "dev": [5, 28, 51], "dev169730": 49, "dev200877": 49, "develop": [0, 2, 3, 4, 7, 11, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 29, 30, 31, 37, 39, 44, 50, 51], "development": [2, 8, 13, 18, 23, 27, 49, 50, 51], "development_stag": 36, "devianc": 32, "deviancefeatureselect": 32, "deviant": [5, 31, 32], "deviat": [2, 14, 15, 21, 23, 34, 41], "devic": [18, 27, 38, 49], "devlin": 1, "devr": 14, "devtool": [8, 11, 27, 28], "dewitt": 49, "dewlnn19": 14, "dexter": 49, "dezel21": 14, "df": [1, 8, 13, 14, 17, 21, 50], "df_bcr": 3, "df_bcr_contig": 3, "df_bcr_raw": 2, "df_count": 3, "df_dist": 4, "df_dist_alpha": 4, "df_dist_beta": 4, "df_donor": 14, "df_ergo": 4, "df_patient": 2, "df_sequenc": 3, "df_tcr": 3, "df_tcr_ergo": 4, "df_tcr_raw": 2, "df_tcrdist": 4, "df_tcrdist_alpha": 4, "df_tcrdist_beta": 4, "df_tcrmatch": 4, "dfgh": [3, 4], "dgcmatrix": [7, 10, 21], "dge": 14, "dgelist": 14, "dhanda": 4, "dhaval": 7, "di": [1, 11, 14, 15, 25, 37], "diag_edg": 27, "diagnosi": 17, "diagnost": [13, 23, 48], "diagon": [13, 16, 23, 36], "diagramm": 25, "diagrammer_1": 25, "diamet": 36, "dian": 49, "diaz": 49, "dicekrig": 25, "dict": [3, 4, 13, 42], "dict_renam": 4, "dict_rename_cov_abdab": 4, "dict_rename_tcrdist": 4, "dictionari": [3, 5, 19, 27, 30], "did": [7, 14, 15, 16, 21, 27, 28, 34, 41, 48, 49], "didn": [5, 7], "diehn": 17, "dielectr": 2, "diem": 23, "dieter": [17, 26], "dietmar": [2, 13, 19], "dietrich": [17, 26], "diez": 24, "diff": [5, 16], "diff_gen": 16, "differ": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 14, 15, 16, 17, 18, 19, 21, 22, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 41, 43, 44, 45, 47, 48, 49, 50, 51], "differenti": [1, 3, 9, 15, 19, 23, 26, 33, 38, 39, 41, 48, 49, 50, 51], "difficult": [3, 5, 7, 13, 21, 23, 24, 26, 43, 49], "diffmap": 50, "diffobj": 25, "diffus": [25, 41, 50], "digest": [7, 21, 24, 49], "digest_0": [8, 25, 27, 28], "diggl": 40, "digit": [14, 16, 17, 23, 24, 49], "digraph": 18, "dijk": [13, 16], "dillman": 17, "dilmtqspssmsvslgdtvsitchasqgigsnigwlqqkpgksfkg": 4, "dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfkg": 4, "dilut": 34, "dim": [7, 8, 14, 17, 21, 27, 28], "dimens": [3, 5, 7, 8, 13, 14, 16, 18, 19, 21, 26, 28, 31, 32, 34, 38, 45, 50], "dimension": [3, 4, 5, 6, 7, 9, 10, 11, 13, 16, 17, 19, 21, 27, 28, 33, 34, 37, 41, 49, 50, 51], "dimitrio": 1, "dimitrov": [15, 25], "dimmel": 23, "dimnam": 11, "dimplot": [10, 27], "dinar": 23, "dine": 4, "ding": [24, 48], "dionn": [13, 22, 50], "diploid": [9, 11], "dir": [8, 23], "direct": [4, 13, 15, 18, 21, 23, 24, 25, 26, 50], "direction": 25, "directli": [1, 2, 3, 4, 5, 7, 11, 15, 16, 17, 19, 21, 23, 24, 26, 32, 33, 36, 37, 39, 40, 51], "directori": [3, 5, 11, 21, 23, 27, 50], "dirichlet": [8, 13], "dirichletmultinomial_1": 8, "dirk": 9, "disadvantag": [5, 25], "disassoci": 51, "discard": [1, 2, 16, 23, 31], "discern": [2, 13, 16], "disclaim": 8, "discourag": 21, "discov": [7, 8, 13, 17, 24], "discover": 1, "discoveri": [1, 4, 13, 14, 16, 23, 29, 30, 38, 49], "discrep": [13, 23], "discret": [13, 14, 18, 50], "discrimin": 23, "discuss": [2, 4, 5, 7, 11, 13, 15, 19, 21, 24, 26, 27, 28, 29, 30, 48, 49], "diseas": [1, 2, 3, 4, 5, 7, 9, 13, 14, 15, 16, 17, 18, 24, 25, 29, 30, 36, 48, 49, 50, 51], "disease_stag": 17, "diseased_sampl": 13, "diseased_tissu": 13, "disentangl": [9, 25, 28], "disk": [18, 19], "disord": 24, "dispar": [24, 49], "dispatch": 21, "dispers": [7, 13, 14, 17, 21, 27, 28, 32, 36, 38], "dispersions_norm": [7, 13, 17, 21, 27, 28], "displai": [1, 3, 6, 7, 13, 23, 34, 36, 42], "displot": [4, 34, 48], "dispos": 49, "disrupt": 30, "dissect": [15, 26], "dissimilar": [25, 49], "dissoci": [7, 24, 25, 36, 38, 39, 49], "dissociation_scor": 36, "dissolv": [9, 24], "dist": 4, "dist_tcrmatch": 4, "dist_tot": 4, "dist_valu": 4, "distal": [5, 8, 11, 26, 50], "distanc": [1, 2, 3, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 21, 23, 27, 28, 31, 36, 37, 38, 40, 41, 43, 44, 45, 49, 51], "distant": [16, 25], "distinct": [5, 7, 9, 11, 13, 15, 16, 17, 23, 24, 25, 30, 36, 41, 49], "distinctli": 13, "distinguish": [5, 11, 13, 16, 23, 24], "distort": [11, 18, 23, 34], "distplot": [4, 26], "distribut": [1, 3, 4, 7, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 34, 36, 38, 41, 46, 47, 48, 49, 50], "div": 42, "diverg": [3, 4, 23, 38], "divers": [2, 3, 5, 7, 9, 13, 23, 24, 25, 30, 39, 49, 50], "divid": [3, 7, 8, 9, 11, 17, 18, 19, 23, 24, 26, 36, 37, 47, 49], "divis": [1, 24, 49], "divmtqshkfmstsigdrvsitckashdvstavawyqqkpgqspkl": 4, "dixon": 50, "diya": 50, "djambazian": 23, "djamel": 11, "djekidel": 16, "dl": 7, "dmap": 17, "dmitri": [16, 31], "dmitrii": 4, "dmitryulyanov": 3, "dmxl2": [5, 12], "dna": [7, 8, 9, 11, 14, 18, 23, 24, 26, 27, 28, 30, 34, 37, 48, 49, 51], "dnaja1": 8, "dnajc6": 12, "dnph1": 8, "dntt": [5, 12], "do": [1, 2, 3, 4, 5, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 27, 28, 29, 33, 36, 37, 39, 45, 46, 48, 49, 51], "doan": 49, "dobin": 23, "doc": [1, 21], "dock": 4, "docrep": 7, "document": [1, 2, 3, 4, 19, 21, 23, 25, 34, 36, 42, 49, 50], "doe": [1, 2, 3, 4, 5, 6, 7, 9, 10, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 31, 34, 36, 38, 41, 45, 48, 51], "doesn": [3, 4, 7, 13, 16, 21, 26], "dogma": [48, 50], "doheon": 15, "doherti": 23, "doi": [2, 4, 5, 6, 7, 9, 11, 13, 14, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "dolrt": 14, "dolton": 4, "domain": [8, 25, 41, 50], "domani": 51, "domck": 49, "domenico": [17, 26], "domin": [1, 3, 7, 15, 24, 26, 31], "dominik": [7, 11, 13, 27, 28, 34, 48, 51], "dom\u00ednguez": 5, "don": [5, 7, 11, 13, 15, 23, 32, 47, 48], "donaghi": 51, "donald": [23, 24, 49], "done": [1, 3, 5, 7, 8, 11, 13, 15, 16, 18, 21, 24, 26, 27, 28, 36, 38, 40, 41, 47, 49, 51], "dong": [5, 14, 16, 23, 25, 37, 39, 50], "dongen": [7, 25], "donghyun": 26, "dongq": 25, "dongz": [23, 51], "doni": [5, 7, 50, 51], "donno": [5, 7, 16, 50], "donor": [3, 4, 5, 7, 8, 14, 15, 17, 19, 26, 27, 28, 34, 43, 44, 45, 46, 47, 48], "donor8": [5, 6], "donor_": 14, "donor_color": [27, 28, 43, 44, 45], "donor_id": 36, "donor_kei": 14, "donorag": [7, 27, 28], "donorbloodtyp": [7, 27, 28], "donorbmi": [7, 27, 28], "donorgend": [7, 27, 28], "donorid": [7, 27, 28], "donornumb": [7, 27, 28], "donorrac": [7, 27, 28], "donors_to_drop": 14, "donorsmok": [7, 27, 28], "doolei": 49, "doparallel": 8, "doparallel_1": [8, 25], "doplot": 34, "dorc": 8, "dorcg": 8, "dorcgen": 8, "dorcjplot": 8, "dorcmat": 8, "dorctab": 8, "dorfman": 33, "dori": 15, "dorin": 50, "dormant": 1, "dorothea": [15, 26], "dose": 16, "dosnow_1": 8, "dot": [4, 11, 13, 19, 23, 25, 36, 38], "dotplot": [5, 25, 43], "dott": 15, "dou": [25, 49], "doubl": [5, 11, 13, 23, 48], "doublet": [2, 3, 4, 16, 18, 31, 33, 36, 48], "doublet_class": 34, "doublet_scor": [11, 34, 36], "doubletdecon": 23, "doubletfind": 23, "doublets_mark": [44, 45, 46], "doublets_markers_color": [44, 45, 46], "dougla": [5, 7, 15, 17, 48, 50], "douw": 7, "down": [1, 5, 7, 9, 13, 14, 15, 26, 49], "downgrad": 1, "download": [2, 3, 4, 5, 8, 11, 15, 16, 19, 21, 23, 25, 26, 36, 50], "download_model": 5, "downregul": 14, "downsampl": [2, 3, 4], "downsamplingindex": 17, "downsamplings": 17, "downstream": [2, 3, 5, 7, 8, 11, 18, 19, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 40, 41, 49, 51], "dpi": [1, 6, 11, 15, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "dplyr": [7, 8, 11, 21, 25], "dplyr_1": [8, 25, 27, 28], "dpp4": 27, "dpt": 50, "dpt_pseudotim": 50, "dr": [17, 25, 27, 37, 49], "dra": [25, 27], "dramat": 1, "drastic": 23, "draw": [2, 8, 16, 23, 24, 49, 51], "drawback": [21, 23], "drawn": [5, 11, 49], "dream": [0, 49], "drenkow": 23, "drew": [17, 26], "dri": 37, "dric": 2, "drive": [5, 9, 26, 50], "driven": [9, 13, 15, 24, 25], "driver": [8, 49], "drop": [2, 3, 4, 5, 7, 11, 14, 15, 18, 23, 24, 25, 34, 36, 49, 51], "drop_dupl": [2, 3, 4, 25, 49], "drop_na": 25, "dropkick": 23, "droplet": [2, 9, 11, 14, 15, 16, 18, 24, 25, 34, 46, 47, 48], "dropletqc": 23, "dropletutil": 23, "droplevel": 15, "dropna": [1, 28], "dropout": [3, 14, 18, 31, 38], "dropout_r": 7, "dropseq": 23, "drost": [3, 4], "drosten": [17, 26], "drs18": 6, "drug": [13, 14, 16, 24], "dry": 24, "ds_g": 51, "dsb": 48, "dsc_loss": 27, "dscmatrix": 10, "dscrna": [23, 51], "dst": 1, "dt": [13, 16, 51], "dt_0": 8, "dtangl": 17, "dtgr": 25, "dtype": [1, 2, 4, 5, 7, 11, 13, 15, 16, 17, 19, 21, 25, 26, 27, 28, 32, 34, 40, 45, 47, 49], "dtypewarn": [1, 2, 3, 49], "du": [4, 6, 17], "du_g": 51, "dual": [2, 23, 49], "dual_ir": [1, 3, 4], "duan": 15, "duart": 8, "dublet": 2, "duccio": 38, "duclo": 7, "ductal": 51, "dudoit": [14, 50], "due": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 21, 23, 24, 26, 28, 29, 31, 33, 34, 36, 43, 44, 46, 47, 48, 49, 51], "duga": [7, 28], "dugourd": [15, 25], "duhe": 50, "dui": 37, "dummi": [7, 13, 36], "dummy_confound": 13, "dunamai": [15, 25], "duong": [5, 7, 15, 50], "dupag": 49, "duplic": [3, 4, 11, 15, 18, 21, 23, 24, 34], "duplicate_count": 1, "duplicate_count_b_vdj": 1, "duplicate_count_b_vj": 1, "dure": [1, 2, 3, 4, 7, 8, 11, 13, 16, 18, 23, 24, 26, 27, 28, 30, 31, 33, 34, 45, 48, 49, 51], "durik": 51, "dusp22": 12, "dutilh": 14, "duygu": 11, "dv5": 1, "dv8": 4, "dvir": 17, "dwl": 17, "dx": [13, 25], "dy": [19, 34], "dye": 24, "dykstra": 49, "dylan": [5, 36], "dylib": [13, 15], "dynam": [1, 18, 23, 24, 25, 31, 48, 50, 51], "dynguidelin": 50, "dysregul": [17, 26, 30], "d\u00e9ne": 25, "e": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 36, 37, 39, 40, 45, 46, 49, 50, 51], "e1000217": 15, "e1005803": 1, "e1008585": 23, "e1009290": 23, "e1010031": 51, "e107": 38, "e1071_1": 25, "e10798": 29, "e11": 40, "e12": 24, "e1364": 24, "e14": 38, "e17": 5, "e21": [7, 37], "e2100293118": 13, "e23": [17, 26], "e29": [5, 27, 28], "e2f2": 38, "e34e908": 21, "e4": [23, 24], "e42": 7, "e47": [14, 15], "e5": [23, 24], "e50": 36, "e6": [5, 34], "e66": 25, "e6v": 24, "e8": 23, "e8746": [14, 22], "e9": 23, "e9620": 7, "e_g": 36, "eaat9804": 49, "eaaw3381": 49, "eaaw8151": 43, "eaba2619": 17, "eabb3099": 49, "eabc1944": 49, "eabl5197": 5, "each": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 47, 48, 50, 51], "earl": 8, "earli": [3, 5, 8, 13, 14, 15, 16, 17, 19, 23, 24, 27, 28, 29, 30, 37, 41, 47, 48, 49, 50, 51], "earlier": [3, 4, 5, 7, 16, 19, 23, 24, 32, 44, 48, 49], "early_stop": [7, 16, 27], "early_stopping_pati": 16, "earlystop": 27, "eas": 5, "easi": [0, 1, 5, 13, 21, 36, 38], "easier": [1, 3, 5, 7, 16, 21, 24, 36, 49], "easiest": [3, 13], "easili": [1, 2, 3, 4, 13, 16, 19, 21, 23, 24, 33, 37, 38, 49], "ebay": 14, "ebert": 15, "ebf1": [5, 12], "ebi": 3, "ebv": 4, "ec": 23, "eccit": 16, "eck": [5, 6, 50], "ecker": 9, "economo": 24, "ecosystem": [7, 13, 16, 18, 19, 22], "ed": [23, 24], "eda": 14, "edg": [1, 7, 8, 13, 18, 23, 26, 27, 30, 49], "edgel": 13, "edger": [13, 15], "edger_": 14, "edger_3": 15, "edger_b_cel": 14, "edger_cd14_monocyt": 14, "edger_cd4_t_cel": 14, "edger_cd8_t_cel": 14, "edger_dendritic_cel": 14, "edger_fcgr3a_monocyt": 14, "edger_nk_cel": 14, "edges_width": 1, "edgeweight": 1, "edit": [1, 4, 16, 18, 23, 49], "editor": [7, 30, 50], "edouard": 7, "eduard": 24, "eduardo": [5, 7, 23, 51], "edward": [15, 37, 41, 49], "ee4b2b": 42, "eef1a1": 16, "eeshit": 7, "efbbcmfz2mmc": 40, "effect": [0, 5, 7, 9, 11, 14, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 38, 44, 46, 48, 49, 50, 51], "effect_df_condit": 13, "effect_nam": 13, "effective_plast": 49, "effector": [1, 3, 5, 12], "effects_bar_plot": 13, "efficaci": [16, 23], "effici": [4, 5, 6, 7, 14, 16, 18, 21, 23, 24, 30, 31, 34, 36, 39, 41, 47, 49, 50, 51], "effort": [0, 7, 13, 19, 23, 26, 29, 49], "efremova": [25, 50], "efthymia": [5, 7, 14, 16, 19, 27, 28, 48, 50], "eg": 7, "egg": 49, "egorov": 4, "egozcu": 13, "egr1": 12, "eharpi": 17, "ehsan": [17, 26], "eickelberg": [5, 7, 50], "eight": [13, 16, 34], "eil": 40, "eileen": 8, "einhard": 49, "eiru": 26, "either": [1, 2, 3, 4, 7, 8, 10, 11, 13, 14, 17, 19, 21, 23, 24, 25, 28, 29, 32, 34, 38, 39, 47, 48, 49, 51], "ekaterina": 4, "el": 3, "el7": 1, "elabor": [5, 24, 34, 39], "elac019": 25, "elaps": [7, 8, 27], "elbo_train": 36, "elbo_valid": [16, 27], "elbow": 23, "eldj": [23, 51], "electr": 24, "electrochem": 9, "electrophoresi": 24, "elegan": 49, "elem": 7, "element": [2, 4, 7, 8, 11, 13, 19, 21, 23, 24, 26, 34, 42], "elena": [7, 17, 25, 26, 50], "eleni": [5, 14, 16, 19, 27, 28, 48, 50], "elev": 3, "elevated_ifng": 3, "eleven": 14, "elhanati": 1, "elicit": 25, "elif": 5, "elimin": [23, 24], "elior": 23, "elisa": [13, 50], "elisabetta": [15, 24, 36], "eliza": 24, "elizabeth": [5, 7, 14, 15, 16, 24, 25, 36, 48, 50], "elliott": 50, "ellipsi": [7, 21], "ellipsis_0": [8, 25, 27, 28], "elmentait": [5, 36], "elmira": 49, "elo": [5, 7, 14, 50], "elosua": 36, "elowitz": 49, "elp": 5, "els": [3, 4, 7, 11, 15, 27, 33, 36, 42, 47], "elsevi": 25, "eltz": 33, "elucid": 14, "elud": 14, "elvira": 3, "em": 23, "email": 30, "emanuel": [17, 26], "emb": [3, 5, 6, 7, 19, 28, 31], "emb_ref_queri": 5, "embed": [3, 4, 5, 6, 8, 10, 13, 15, 16, 19, 21, 26, 28, 31, 36, 44, 45, 50, 51], "embeding_vector": 3, "embopress": [14, 22, 29], "embryo": 49, "embryogenesi": [49, 50], "embryon": [24, 49], "embyrogenesi": 49, "emcj": 1, "emeli": [7, 50, 51], "emerg": [17, 25, 39, 49], "emerton": 2, "emi": 49, "emili": [1, 2, 4, 23, 24, 50], "emit": [18, 24], "emma": [13, 14, 24, 36, 39, 50], "emmanuel": [5, 7, 14, 17, 26, 48, 50], "emp_nul": 13, "emphas": [16, 30], "emphasis": [7, 21], "empir": [7, 14, 15, 16, 27, 28, 32, 33, 41], "emploi": [16, 23, 25, 30, 49], "empti": [1, 11, 21, 25, 34, 47, 48], "emptydrop": 23, "emptydropscellrang": 23, "emptyset": 23, "emr": 23, "emuls": 9, "en": [5, 6, 7, 15, 19, 21, 27, 50], "en_u": [25, 27, 28], "enabl": [2, 3, 5, 6, 7, 9, 11, 13, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 39, 41, 48, 49, 50], "enable_plugin_devic": 5, "enard": [23, 24], "encapsul": [23, 24], "enclos": 18, "encod": [2, 3, 7, 11, 16, 18, 23, 26, 27, 36, 37], "encode_data": 27, "encode_tcr": 3, "encompass": 7, "encount": [11, 13, 17, 21, 23, 36], "encourag": [5, 19, 21, 22, 24, 30, 51], "end": [1, 2, 3, 4, 5, 7, 8, 9, 11, 14, 18, 21, 23, 24, 25, 40, 48, 51], "endo": 16, "endocrin": [13, 25, 51], "endotheli": [5, 36], "enforc": [7, 11, 16, 38], "eng": [24, 37], "engag": [8, 30], "engelbert": [25, 50], "engelhardt": 5, "engelmann": 5, "engin": [21, 49], "england": 14, "enhanc": [6, 8, 23, 25, 26, 30, 37, 38, 49], "enough": [7, 11, 13, 15, 16, 24, 25], "enrich": [2, 4, 8, 13, 17, 23, 25, 26, 40, 47, 48, 49], "enrichr": 15, "ensdb": 10, "ensembl": [15, 23, 26, 34, 36], "ensg00000120705": 23, "ensg00000186092": [19, 36], "ensg00000187642": 36, "ensg00000187961": 7, "ensg00000188290": 36, "ensg00000188976": [7, 36], "ensg00000198695": 7, "ensg00000198727": 7, "ensg00000198786": 7, "ensg00000198961": 23, "ensg00000215611": 19, "ensg00000215616": 19, "ensg00000215635": 19, "ensg00000228794": [7, 36], "ensg00000237491": [7, 36], "ensg00000237613": [19, 36], "ensg00000238009": [19, 36], "ensg00000239945": [19, 36], "ensg00000241860": 7, "ensg00000243485": [19, 36], "ensg00000245526": 23, "ensg00000251180": 19, "ensg00000268590": 19, "ensg00000271254": 7, "ensg00000273748": 7, "ensur": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "entail": [16, 24, 37], "enter": [14, 38, 47, 49], "entero_ix": 13, "enterocyt": 13, "entir": [1, 5, 9, 11, 16, 17, 23, 24, 30, 36, 38, 48, 49, 51], "entireti": [0, 23], "entiti": [24, 25, 36], "entitl": 49, "entpd1": 27, "entri": [2, 4, 5, 7, 11, 23, 27, 38], "entropi": 7, "entrypoint": [1, 7, 15, 25], "enumer": [14, 15, 26, 36, 38], "env": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "environ": [1, 2, 3, 4, 6, 7, 8, 11, 13, 15, 16, 19, 21, 23, 24, 31, 32, 33, 36, 38, 43], "environment": [1, 24], "environment_nam": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "envis": 29, "enzym": [2, 9, 18, 24, 25], "eosinophil": 17, "ep": 51, "epha4": [5, 12], "epigenet": [8, 9, 15, 24], "epigenom": 8, "episcanpi": 8, "epitheli": [5, 13, 15, 50], "epithelium": [13, 22, 49], "epitop": [1, 2, 3, 16, 47, 48, 50], "epn2": 8, "epoch": [5, 7, 16, 27, 28, 36, 37, 38], "epsilon": [36, 51], "epsilon_g": 36, "epstein": 4, "epsti1": 25, "equal": [3, 7, 11, 13, 14, 16, 18, 19, 23, 25, 33, 49], "equat": [17, 48, 51], "equilibria": 51, "equilibrium": 51, "equip": 49, "equival": [7, 19, 23, 26, 27, 28, 31, 50], "er": [5, 7, 23, 50, 51], "eran": [9, 23], "eraslan": 7, "erb": 47, "ercument": 11, "erdogan": 23, "ergen": 36, "ergo": 4, "ergo_input": 4, "erhan": 23, "erhard": 50, "eri": 12, "eric": [4, 15, 16, 36, 39, 41, 50], "erica": [5, 14, 19, 23, 27, 28], "erick": 25, "ericson": [23, 24], "erik": [17, 26, 50, 51], "erji": 15, "erkan": 23, "erl": 23, "eroglu": 11, "erron": [23, 24, 51], "error": [1, 2, 3, 5, 11, 13, 14, 16, 17, 18, 24, 26, 27, 28, 32, 33, 34, 38, 49, 50], "erwin": 24, "ery_1": 50, "ery_2": 50, "eryani": [2, 24], "erythroblast": [5, 7, 12], "erythrocyt": 5, "erythroid": [5, 50, 51], "erythrophagocyt": 5, "es_clon": 49, "esc": 49, "escap": 16, "escherichia": 26, "esen": 13, "eset": 17, "esfahani": 17, "especi": [2, 3, 4, 5, 6, 7, 13, 14, 19, 21, 23, 24, 27, 29, 33, 36, 43, 45, 48, 49, 50], "espeland": 14, "espinosa": 23, "esrra": 41, "essenti": [5, 9, 13, 16, 18, 23, 25, 29, 30, 33, 37, 39, 48], "esser": 51, "est": 34, "establish": [1, 15, 21, 22, 23, 25, 33], "estat": 48, "esteban": 37, "estim": [2, 3, 11, 13, 14, 15, 16, 18, 23, 24, 26, 27, 29, 33, 34, 36, 38, 41, 47, 49, 50, 51], "estimate_balancing_weight": 27, "estimatedisp": 14, "estrada": 48, "et": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "etc": [2, 3, 4, 5, 7, 14, 15, 21, 23, 26, 34], "ete3": 14, "ethen": 9, "ethnic": [7, 27, 28], "etienn": [6, 22], "etil": 7, "etp": 5, "etv6": 5, "eu": 2, "euchromatin": 9, "euclidean": [6, 31, 37], "eui": 1, "eukaryot": [24, 26], "eun": [2, 7, 26], "eunic": [14, 15, 16, 25], "eunjung": 15, "europ": [7, 21], "eval_adata": 16, "evalu": [3, 4, 5, 6, 7, 11, 13, 15, 17, 23, 25, 27, 30, 32, 33, 34, 49], "evaluate_0": 8, "evan": [7, 23, 24, 34, 36, 38], "evas": 16, "evavold": 2, "even": [0, 1, 2, 3, 4, 5, 7, 9, 11, 13, 15, 16, 19, 21, 23, 24, 27, 28, 29, 38, 43, 49, 50, 51], "event": [1, 11, 15, 18, 24, 25, 26, 31, 41, 51], "eventu": [2, 16, 24], "ever": 25, "everi": [1, 2, 4, 5, 7, 9, 11, 13, 14, 15, 16, 22, 24, 25, 26, 30, 38, 41, 49], "everyth": [14, 19, 34], "evgeni": [5, 7, 16, 50], "evgenia": 49, "evgenii": 4, "evgenij": 7, "evid": [1, 3, 4, 8, 16, 19, 23, 26], "evolut": [2, 21, 49], "evolution4": 21, "evolutionari": [24, 49], "evolv": [15, 22, 24, 29, 34], "evqlqqsgpelvkpgasvkisckasgysfnnyymnwvkqspeksl": 4, "evqlqqsgpelvkpgasvkisckasgysftdyymnwvkqspeksl": 4, "evqlqqsgpelvkpgasvkisckasgysftgyymnwvkqspeksl": 4, "evttvt20": 25, "ewa": 14, "ex": 3, "exacerb": 49, "exact": [1, 4, 7, 14, 15, 23, 30, 32, 39, 43, 50], "exactli": [5, 7, 23, 25, 28, 36, 38, 50], "exagger": 7, "examin": [3, 11, 13, 14, 16, 19, 23, 24, 25, 30, 36], "exampl": [1, 2, 3, 4, 5, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 48, 49, 50, 51], "examplatori": 4, "example_data_glob": 13, "example_data_sampl": 13, "exce": [37, 49], "exceed": [34, 48], "excel": 49, "except": [1, 2, 4, 13, 16, 23, 24], "excess": [14, 34], "excis": 23, "excit": 49, "excitatori": 16, "exclam": 23, "exclud": [3, 4, 5, 11, 13, 14, 15, 22, 32, 34, 36], "exclus": [19, 22, 25, 46], "execut": [7, 13, 15, 16, 18, 21, 23, 25, 26, 34], "exemplari": [36, 43], "exercis": 9, "exert": 14, "exhaust": [30, 49, 50], "exhibit": [14, 23, 24, 30, 51], "exist": [2, 3, 4, 5, 7, 8, 13, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 34, 43, 46, 47, 49], "exist_ok": 51, "exogen": 49, "exon": [18, 23, 24, 51], "exp": [3, 37, 40], "expand": [1, 3, 16, 23, 25, 49], "expanded_onli": 1, "expanding_nod": 49, "expans": [3, 4], "expansion_pvalu": 49, "exparc": 24, "expawsh16": 24, "expbhm": 24, "expda": 24, "expdsz": 24, "expect": [1, 3, 4, 5, 6, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 28, 29, 33, 36, 37, 38, 39, 40, 47, 48, 49, 51], "expected_dict": 36, "expected_orient": 23, "expens": [1, 4, 11, 17, 23, 24, 39], "experi": [0, 1, 3, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 27, 28, 30, 32, 33, 34, 36, 47, 48, 49, 51], "experienc": [23, 30], "experiment": [1, 3, 4, 7, 13, 14, 16, 17, 19, 23, 24, 25, 26, 28, 33, 39, 45, 49, 50, 51], "experimentalist": 49, "experimentlist": 21, "expert": [5, 7, 27, 30], "expflu22": 24, "expgch": 24, "exphhs87": 24, "exphtt17": 24, "expir": 2, "expiry_1": 8, "expizj": 24, "expjhyf72": 24, "expjopa16": 24, "expkgn": 24, "expkma": 24, "expkvaharautiok": 24, "explain": [1, 3, 4, 8, 9, 13, 14, 15, 19, 22, 23, 24, 26, 30, 36, 50], "explan": [2, 3, 4, 15, 22, 23, 40, 42], "explanation_text": 42, "explanatori": 1, "explicit": 38, "explicitli": [7, 11, 13, 14, 19, 23, 27, 33], "explmbw20": 24, "explmph18": 24, "exploit": 1, "explor": [1, 3, 5, 8, 9, 13, 14, 21, 22, 26, 30, 33, 44], "exploratori": [8, 14, 19, 24], "explore_3": [25, 28], "expm1": 3, "expmb": 24, "expmlm": 24, "exponenti": 49, "export": [3, 8, 23, 32, 36], "export_posterior": 36, "exportclass": 21, "expos": 23, "exposur": 4, "exppwt": 24, "expr": [7, 11, 15], "expr_prod": 25, "expr_prop": 25, "express": [2, 3, 6, 7, 8, 9, 13, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 39, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "expressed_gen": 25, "expressed_ligand": 25, "expressed_receptor": 25, "expression_level": 38, "expression_mtx_fnam": 26, "expressionset": 17, "expsaec": 24, "expsnl": 24, "exptyg": 24, "expwhz": 24, "expzll": 24, "expztb": 24, "expzvp": 24, "ext": 27, "extend": [3, 5, 13, 19, 22, 23, 27, 29, 36, 37, 49], "extend_txom": 23, "extens": [2, 3, 5, 7, 11, 13, 16, 17, 19, 21, 22, 23, 24, 25, 30, 33, 36, 49, 51], "extent": [5, 7, 13, 19], "extern": [1, 16, 23, 25, 26, 28, 30, 49], "extra": [2, 7, 25, 34], "extra_chain": 2, "extract": [1, 2, 3, 4, 8, 9, 10, 11, 15, 16, 17, 19, 21, 23, 24, 25, 28, 36, 37, 41, 49, 51], "extract_edge_weight": 1, "extrapol": 16, "extrem": [5, 11, 19, 49, 50, 51], "ey": 49, "eyal": 36, "eytan": 51, "f": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "f0t1h": 23, "f1000research": [2, 5, 6, 7, 11, 14, 15], "f811": 27, "f_j": 38, "fa": [23, 27], "fabian": [2, 3, 5, 6, 7, 9, 11, 14, 16, 17, 19, 22, 23, 25, 27, 28, 29, 30, 34, 36, 37, 40, 41, 48, 50, 51], "fabiana": 8, "fabio": [2, 24], "fac": [2, 5, 13, 17, 24], "face": [30, 38], "facecolor": [6, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "facetgrid": [13, 48], "facil": [7, 24], "facilit": [1, 16, 19, 23, 49], "fact": [1, 7, 13, 15, 16, 18, 23, 24, 25, 31, 38, 47, 48, 51], "factor": [4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 33, 49], "factor_nam": 36, "factor_names_": 36, "factoris": 36, "fail": [1, 5, 13, 14, 16, 17, 23, 27, 28, 48, 50, 51], "failur": [5, 16, 18, 23, 51], "fairli": 25, "faith": 16, "faithfulli": 51, "faiz": 5, "falai": [36, 38], "falco": 23, "falk": [5, 7, 50], "fall": [1, 5, 13, 16, 23, 26, 27, 28, 36, 38, 39, 48], "fals": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 49, 51], "fam138a": [19, 36], "famili": [7, 8, 13, 14, 21, 23], "familiar": [13, 15, 21, 30], "famou": [16, 49], "fan": [5, 7, 15, 23, 44, 50, 51], "fanci": [19, 29], "fanelli": 38, "fang": [9, 26, 36, 38, 49], "fangm": 9, "fanni": 7, "fansi": [7, 21], "fansi_1": [8, 25, 27, 28], "far": [1, 5, 11, 23, 24, 32, 40, 46, 51], "faraz": 23, "farber": 5, "fardeep": 17, "farouni": 23, "farrar": 23, "farrel": 7, "farver_2": [8, 27], "fashion": [3, 34, 36], "fasouli": 5, "fast": [5, 6, 7, 15, 16, 19, 23, 24, 29, 33, 34, 39, 41, 44, 49], "fasta": 23, "fastdummies_1": 27, "fasten": 1, "faster": [1, 5, 8, 11, 13, 15, 16, 18, 23, 38, 49], "fastest": 7, "fastjsonschema": 21, "fastmap": [7, 21], "fastmap_1": [8, 25, 27, 28], "fastmnn": 7, "fastq": [18, 23], "fastq_dir": 23, "fastqc": 23, "fate": [3, 48, 49, 50, 51], "fatemeh": [14, 23], "fault": 16, "faust": 17, "favor": [14, 23, 24], "favour": [7, 33], "faw": 3, "fb": 49, "fbxo31": 41, "fc": [2, 14], "fcer1a": [5, 12], "fcer1g": [5, 12], "fcer2": 27, "fceria": 12, "fcgr3a": [5, 12, 15, 16, 25, 27], "fcgr3a_monocyt": 14, "fcn1": [5, 12], "fcrl1": [5, 12], "fct": 10, "fd": 26, "fdim": 49, "fdr": [13, 14, 15], "fdrtool_1": 25, "fearghal": 51, "feasibl": 4, "feat": 27, "feather": 26, "feather_0": 8, "featur": [1, 3, 4, 5, 10, 13, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 39, 41, 45, 47, 48, 49, 50], "feature_biotyp": 36, "feature_id": 36, "feature_is_filt": 36, "feature_nam": [13, 36], "feature_refer": 36, "feature_typ": [7, 10, 11, 19, 21, 26, 27, 28, 34, 36, 37, 43, 44, 45, 46, 47, 48], "featureplot": 10, "feb": [13, 14, 17, 19, 21, 22, 24, 25, 30, 37, 40, 41, 48], "februari": [5, 7, 9, 23, 24, 36, 41], "fed": 27, "federico": 22, "fedrigo": 24, "feedback": [30, 42], "feedbackid": 42, "feel": [5, 11, 16, 30, 38], "feet": 24, "fei": [15, 16, 36, 37], "feiyang": 17, "fel81": 49, "felicia": 48, "felix": [3, 4, 14, 17, 23, 26], "felsenstein": 49, "femal": 2, "feng": [24, 26, 37, 39, 41, 49], "fengcui": 26, "fennel": 24, "ferguson": [2, 24], "fernand": [13, 48, 50], "fernandez": 27, "fernando": [1, 2, 49], "fern\u00e1ndez": 36, "ferri": 23, "fertil": [1, 49], "fetal": [38, 50], "fetch": [11, 16, 19, 23], "few": [1, 5, 7, 11, 13, 14, 15, 16, 19, 21, 23, 26, 28, 31, 34, 36, 37, 38, 39, 41, 43, 44, 49, 50, 51], "fewer": [6, 7, 14, 34, 37, 49], "fgene": [13, 23, 31], "fgsae": 15, "fgsea": 15, "fhl2": 15, "fibroblast": [5, 14, 36], "ficht": 49, "field": [0, 2, 5, 7, 8, 14, 15, 17, 22, 24, 25, 29, 30, 37, 38, 49, 50, 51], "fieldwork": 24, "fier": 24, "fifth": [7, 11, 27, 28, 34, 48, 50], "fig": [4, 5, 7, 11, 13, 14, 23, 25, 26, 33, 36, 38, 49], "fig_kw": [1, 3], "fight": [2, 5], "figr": 11, "figr_0": 8, "figshar": [2, 3, 5, 7, 11, 15, 25, 31, 32, 33, 34, 36, 38, 43, 44, 45, 46, 47, 48], "figsiz": [1, 3, 4, 5, 11, 13, 15, 16, 25, 26, 33, 36, 37, 38, 40, 49], "figuera": 13, "figueroa": 16, "figur": [4, 5, 9, 11, 13, 16, 23, 25, 36, 49], "figure_s": 25, "filament": 24, "filbi": 50, "file": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "file102cfa97cc51": 21, "file_path": 51, "fileext": 21, "filelock_1": 8, "filenam": [2, 3, 5, 19, 23, 31, 32, 33, 34, 36, 38, 48], "fill": [4, 11, 19], "fillna": 4, "film": 2, "filt": 8, "filter": [3, 4, 5, 7, 8, 14, 16, 17, 18, 19, 23, 24, 25, 33, 36, 37, 38, 46, 47, 48, 50, 51], "filter_and_norm": 51, "filter_cel": [14, 19, 25, 48], "filter_gen": [7, 14, 19, 25, 34, 36, 37, 50], "filter_intbcs_final_lineag": 49, "filter_lambda": 25, "filter_ob": [11, 19], "filter_rank_genes_group": 5, "filter_var": [11, 19, 45], "filterbi": 25, "filterbyexpr": [14, 15], "filtered_contig_annot": 2, "filtered_contig_annotations_csvfil": 3, "filtered_feature_bc_matrix": [11, 19, 34], "filterwarn": [1, 2, 3, 4, 5, 13, 14, 15, 16, 26, 27, 28, 47], "finak": 14, "final": [1, 2, 3, 4, 5, 6, 7, 9, 10, 13, 14, 15, 16, 17, 19, 23, 24, 25, 27, 28, 30, 34, 36, 40, 48, 49, 50], "find": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 21, 23, 24, 27, 28, 33, 36, 37, 40, 41, 43, 49, 50], "find_de_mast_r": 14, "find_hotspot_featur": 3, "find_pandoc": 8, "findbridgetransferanchor": 27, "findintegrationanchor": [7, 28], "findlai": 49, "findmultimodalneighbor": 28, "findtransferanchor": 27, "findvariablefeatur": 7, "fine": [5, 7, 16, 26, 27, 36, 43, 50], "finer": [5, 6, 7], "fingerprint": 16, "finish": [3, 5, 8, 28, 36, 37, 38, 40, 41, 50, 51], "finotello": [2, 13, 19], "fiona": [6, 15, 50], "fior": [3, 4], "first": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 25, 27, 28, 29, 31, 33, 34, 36, 37, 38, 40, 41, 43, 47, 48, 49, 50, 51], "firstli": [6, 21, 34], "fischer": [3, 7, 9, 19, 24, 25, 28, 29, 37, 40, 41], "fish": 38, "fisher": 15, "fishpond": 23, "fiskin": 7, "fit": [5, 7, 11, 14, 16, 19, 23, 24, 25, 27, 28, 32, 38, 48, 49, 51], "fit_alpha": 51, "fit_beta": 51, "fit_gamma": 51, "fit_likelihood": 51, "fit_model": 14, "fit_par": 51, "fit_reg": 14, "fit_scglu": 27, "fit_transform": 19, "fitargsd": 14, "fitch": 49, "fitdistrplu": [7, 21], "fitdistrplus_1": [8, 25, 27, 28], "five": [1, 7, 16, 51], "fix": [1, 4, 13, 14, 15, 18, 21, 27, 28, 33, 36], "fix_dtyp": 14, "fixedformatt": 1, "fixedloc": 1, "flag": [2, 5, 14, 23, 26, 46], "flanagan": 5, "flank": [9, 11], "flat": 21, "flatten": [26, 47], "flavel": 13, "flavor": [7, 15, 17, 21, 26], "flavour": 36, "flax": 7, "fle": 15, "fleme": [5, 14, 19, 27, 28], "fleri": 4, "fletcher": 50, "flex": 42, "flexibl": [4, 7, 14, 15, 21, 23, 24, 30], "flh": 49, "flip": 42, "flip_card": 42, "flkekggl": 4, "float": [1, 4, 14, 17], "float32": [5, 7, 11, 13, 19, 21], "float64": [7, 11, 16, 17, 21, 26], "float_0": 8, "flongl": 24, "flora": 49, "flore": [15, 25, 36], "florenc": 49, "florescu": [14, 49], "florian": [2, 3, 4, 13, 15, 17, 19, 22, 26, 29, 36, 47, 48, 50], "flow": [1, 2, 6, 24, 30, 48], "flowcel": [18, 23], "floyd": 24, "flt4": 38, "fluctuat": 23, "fluoresc": [2, 18, 24, 38, 49], "fmicb": 13, "fname": [44, 45, 46, 47, 48], "fndc3b": [5, 12], "fnn": 8, "fnn_1": 8, "fo": [7, 12], "focu": [3, 4, 5, 6, 7, 9, 14, 15, 19, 21, 23, 25, 38, 46, 48, 49], "focus": [1, 3, 4, 7, 17, 19, 21, 22, 23, 25, 32, 49], "fold": [13, 14, 15, 23, 25, 51], "folder": [3, 19, 21, 23, 49], "follicular": 5, "follow": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "fong": [23, 24], "font": [8, 42], "font_famili": 8, "fontconfig": [14, 27], "fontfamili": 8, "fontsiz": [7, 8], "fonttool": [1, 25], "foo": [19, 40], "footprint": [10, 15, 25], "foral": 36, "forc": [7, 13, 23, 24, 26], "force_upd": 5, "foreach_1": [8, 25], "forecast": 16, "foreground": 28, "foreign": [1, 2], "foreign_0": 25, "foremost": [13, 49], "forest": 16, "forg": [1, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "forget": 0, "fork": 13, "form": [2, 3, 4, 6, 9, 13, 14, 16, 19, 24, 25, 26, 28, 32, 33, 34, 36, 37, 41, 44, 49, 50, 51], "formal": [30, 38], "format": [1, 3, 4, 7, 8, 13, 15, 16, 18, 19, 23, 24, 25, 26, 34, 49], "format_contrast_result": 25, "former": [23, 24, 32], "formerli": 4, "formul": [36, 37, 51], "formula": [13, 14, 33], "formula_1": 25, "forouzmand": 49, "forrest": 25, "forrow": 49, "forth": [5, 49], "fortun": 49, "forum": [11, 27, 28, 34, 48], "forward": 23, "foster": 16, "fotaki": [2, 13, 19], "foti": 23, "found": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 34, 36, 37, 38, 49, 50, 51], "foundat": [19, 21, 22, 23, 30], "four": [1, 4, 13, 16, 23, 28, 34, 36, 38, 48, 49, 51], "fourth": [1, 49], "fov": 38, "foxp3": 12, "fp": 25, "fpd": 4, "fpr": 21, "fpr1": [8, 12], "fqdn": 21, "fr": 36, "frac": [23, 33, 38, 40, 41, 48, 51], "frac_atac": 8, "fraction": [1, 2, 4, 5, 11, 13, 17, 19, 23, 32, 34, 49], "frag_path": 11, "fragmen_fil": 10, "fragment": [2, 9, 10, 18, 19, 23, 24, 28], "fragment_fil": 10, "fragment_histogram": 11, "frame": [2, 7, 8, 10, 11, 14, 15, 17, 19, 21, 24, 25, 28, 34], "frameon": [1, 5, 6, 15, 16, 25, 27, 28, 31, 32, 33, 34, 38, 43, 44, 45, 46, 47, 48, 51], "framework": [0, 4, 9, 13, 14, 15, 17, 21, 22, 23, 25, 27, 28, 32, 33, 34, 37, 40, 41, 48, 49, 50, 51], "fran": 8, "franc": 42, "franca": 36, "francesca": [2, 13, 19], "franci": 40, "francisco": 24, "francoi": 1, "frangieh": 16, "frank": [23, 24], "franklin": 24, "franz": 15, "fraticelli": 49, "fred": 24, "frederick": [24, 49], "fredrik": 49, "free": [11, 13, 16, 19, 23, 25, 30, 34, 50], "freeze_dropout": 5, "freq": [14, 49], "frequenc": [1, 3, 4, 13, 16, 23, 24, 49], "frequent": [4, 16, 19, 23, 24], "frequentist": 13, "fresh": 24, "freytag": 6, "frieda": 49, "friedel": 50, "friedman": [1, 4], "friedrich": 24, "friendli": [19, 22], "frishberg": 17, "from": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 50, 51], "from_dict": 49, "from_iter": 15, "from_record": 15, "from_scirpi": 1, "from_scvi_model": 7, "front": [13, 42], "front_color": 42, "front_font_s": 42, "frontier": [1, 2, 4, 13, 23, 31], "frontiersin": [13, 31], "frozen": 24, "frugal": [23, 51], "fry": 51, "fry_result": 15, "fry_results_negative_ctrl": 15, "fs21": 49, "fsgsr20": 32, "fsspec": [1, 7], "fsthai19": 32, "fsv": 41, "fth1": [14, 16, 36], "ftl": 14, "ftlnnstedt": 6, "fu": [5, 37], "fuent": 40, "fuert": 24, "fufa": 7, "fujiwara": 5, "fulfil": [1, 13], "full": [2, 3, 4, 5, 8, 11, 13, 14, 19, 24, 26, 27, 28, 29, 30, 36, 41, 47, 48, 49, 50, 51], "full_clust": 3, "full_combin": 1, "full_data": 27, "full_length": 2, "fullam": 49, "fulli": [5, 7, 16, 19, 24], "fullinmemori": 11, "fun": [15, 19], "function": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 47, 49, 50, 51], "function_bas": 17, "functool": [21, 25], "fundament": [0, 16, 18, 19, 22, 23, 24, 25, 30, 49], "funstion": 11, "fuqua": 49, "furchtgott": 49, "furlan": [50, 51], "furlong": 8, "further": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 16, 19, 21, 23, 24, 25, 26, 29, 30, 31, 34, 38, 44, 48, 49], "furthermor": [1, 5, 7, 9, 10, 11, 13, 15, 22, 25, 29, 48], "fuse": 3, "fusion": 24, "futil": 26, "futur": [3, 4, 7, 11, 15, 18, 19, 21, 25, 27, 28, 49, 50, 51], "future_1": [25, 27, 28], "future_fstr": 1, "futurewarn": [1, 2, 3, 4, 7, 11, 15, 19], "fuxiang": 37, "fw": 23, "fxyd1": 15, "fxyd7": 15, "g": [1, 2, 3, 4, 5, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 30, 32, 33, 36, 38, 39, 41, 46, 48, 49, 50, 51], "g2m": 16, "g2m_score": 51, "g_": 38, "g_elbo": 27, "g_kl": 27, "g_nll": 27, "gaatcaccacggaagt": 27, "gabitto": [7, 28], "gabriel": [7, 13, 38], "gabriela": 15, "gaccaatcaatttcgg": [27, 28], "gadala": 1, "gag": 24, "gage": 24, "gagga": 49, "gagneur": [9, 28], "gagnon": 49, "gagttgtcagtcggaa": 28, "gai": [5, 7, 50], "gain": [1, 13, 16, 30, 49], "galagan": 26, "galaxi": 23, "galen": 7, "galm": 25, "gama": 26, "gamerith": 13, "gamma": [3, 5, 36], "gamma_g": 51, "gan": 15, "ganz": 49, "gao": [15, 23, 25, 26, 27, 49, 51], "gaom": 15, "gap": [2, 4, 19, 23, 25, 48], "gapml": 49, "garbag": 16, "garcia": [11, 15, 25, 26], "gardeux": 50, "gari": [1, 2, 50], "garnett": [5, 15], "garren": 24, "garrett": [13, 22], "garri": 4, "garrido": 25, "garritano": 25, "garsk": 23, "gartland": [3, 4], "gartner": [11, 23], "gastro": 40, "gastroenterologi": 40, "gastrul": 5, "gata1": 12, "gata2": [12, 17], "gata3": 8, "gatat": 49, "gatataattc": 49, "gatatccgaa": 49, "gatekeep": 43, "gather": [17, 24], "gatto": [19, 22], "gaujoux": 17, "gaussian": [16, 28, 31, 41], "gautier": [14, 16], "gave": [1, 49], "gayoso": [5, 7, 9, 27, 28, 36, 50, 51], "gb": [13, 24], "gbh": 49, "gc": [23, 24, 33], "gca": [26, 49], "gcaggctgttgcatac": 27, "gcattagcataagcgg": [27, 28], "gcc": [1, 25], "gccatgatcccttgcg": 7, "gcctacttaagtccr1": 49, "gcgga": 49, "gcggaaagtacgcgtc": 27, "gctacaacagtgcgct": 28, "gctgggtgtacggatg": 27, "gdk": 49, "gdo": 16, "gdt": [1, 2, 12], "ge": [23, 24, 27], "geffer": [17, 26], "gehr": [23, 51], "geiger": 16, "geiss": 15, "geistling": [21, 22], "gel": 9, "gelfand": 40, "gem": 9, "gen_loss": 27, "gencod": 23, "gender": [2, 14, 15], "gene": [2, 3, 4, 6, 9, 10, 11, 13, 17, 18, 19, 21, 23, 24, 27, 28, 30, 31, 32, 33, 34, 39, 40, 43, 44, 48, 49, 50, 51], "gene_": [19, 21], "gene_0": [19, 21], "gene_1": [19, 21], "gene_1990": 19, "gene_1991": 19, "gene_1992": 19, "gene_1993": 19, "gene_1994": 19, "gene_1995": 19, "gene_1996": 19, "gene_1997": 19, "gene_1998": [19, 21], "gene_1999": [19, 21], "gene_2": 19, "gene_3": 19, "gene_4": 19, "gene_5": 19, "gene_6": 19, "gene_7": 19, "gene_8": 19, "gene_9": 19, "gene_act": 10, "gene_activity_": 10, "gene_annotation_gtf": 23, "gene_bas": 26, "gene_id": [5, 7, 10, 11, 19, 21, 27, 28, 34, 36, 37, 43, 44, 45, 46, 47, 48], "gene_likelihood": 7, "gene_list": 16, "gene_nam": [5, 11], "gene_stuff": 19, "gene_symbol": [14, 26], "gene_target": 16, "gene_to_lowercas": 38, "geneactivity_": 10, "genelist": 8, "gener": [1, 2, 3, 4, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 41, 43, 44, 45, 48, 49, 50], "generaliz": 5, "generalmatrix": 10, "generate_network": 1, "generate_sample_level": 13, "generics_0": [8, 25, 27, 28], "genes2filt": 46, "genes_vs_motif": 26, "geneset": [14, 15, 25], "geneset_oi": 25, "geneset_s": 15, "genesi": 49, "genesymbol": 15, "genet": [1, 2, 8, 9, 13, 14, 15, 16, 18, 23, 24, 25, 30, 31, 39, 49], "geneviev": 51, "gennadi": [15, 23], "gennert": 7, "genom": [2, 3, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 24, 25, 26, 27, 28, 30, 32, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50, 51], "genome_fasta": 23, "genome_fil": 23, "genomebiologi": 11, "genomeinfodb": [7, 21], "genomeinfodb_1": [8, 15, 27, 28], "genomeinfodbdata": [7, 21], "genomeinfodbdata_1": [8, 15, 27, 28], "genomicalignments_1": 8, "genomicrang": [7, 11, 21], "genomicranges_1": [8, 15, 27, 28], "genotyp": [16, 24], "gentil": 50, "gentl": 17, "gentleman": [19, 22], "geoff": [23, 24], "geoffrei": 49, "geol": 13, "geom": [7, 21], "geom_3": [25, 27, 28], "geom_label_repel": 8, "geom_point": 8, "geom_point_rast": 8, "geom_seg": 10, "geom_text_repel": 8, "geometr": [5, 13, 25, 47], "georg": [3, 4, 11, 13, 17, 26, 37, 49], "georgio": [2, 13, 19], "gephart": 24, "gerald": 49, "gereon": [17, 26], "germain": [11, 32, 33, 34], "germani": 42, "germin": 5, "germlin": 1, "germline_align": 1, "gerold": 13, "gerrit": 49, "gerstein": 51, "gerstung": [36, 49], "gersuk": 14, "gert": [8, 9, 15, 23, 26], "gertruda": 51, "gesmira": 27, "get": [1, 2, 3, 5, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 24, 25, 26, 27, 29, 30, 33, 34, 37, 38, 39, 41, 42, 50], "get_attribut": 49, "get_cmap": 7, "get_contrast": 25, "get_convers": 28, "get_expressed_gen": 25, "get_gene_annotation_from_rna": 19, "get_lat": 3, "get_latent_represent": [5, 7, 13, 16, 27, 28], "get_legend": 38, "get_plugin_device_cli": 5, "get_pseudobulk": 25, "get_resourc": 15, "get_vers": [1, 15, 25], "get_weighted_ligand_target_link": 25, "get_ylim": 26, "getassaydata": [7, 21], "getattr": [11, 36], "getdorcscor": 8, "getelementbyid": 42, "getgrangesfromensdb": 10, "getnnz": 25, "getoptlong_1": [8, 25], "geurt": [15, 26], "gex": [7, 26, 48], "gex_data": 3, "gex_data_typ": 3, "gex_n_count": [7, 27, 28], "gex_n_gen": [7, 27, 28], "gex_n_genes_by_count": [27, 28], "gex_pct_counts_mt": [7, 27, 28], "gex_phas": [7, 27, 28], "gex_pseudotime_ord": [7, 27, 28], "gex_size_factor": [7, 27, 28], "gex_x_pca": [7, 27, 28], "gex_x_umap": [7, 8, 26, 27, 28], "ggaatg": 49, "ggaca": 49, "ggaccgaagtgaggta": 7, "ggbeeswarm_0": 8, "ggcgga": 49, "gggcactaggatgtat": 3, "ggh": 49, "ggplot": [8, 25], "ggplot2": [7, 8, 21, 25], "ggplot2_3": [8, 25, 27, 28], "ggpubr": 25, "ggrastr": [8, 11], "ggrastr_1": 8, "ggrepel": [7, 8, 21], "ggrepel_0": [8, 25, 27, 28], "ggridg": [7, 21], "ggridges_0": [25, 27, 28], "ggtitl": 8, "ghamdan": [2, 24], "ghazanfar": [7, 51], "ghn": [3, 4], "ghrl": 51, "giaa151": [23, 34], "giab061": 7, "giac001": 23, "giacomo": [14, 25], "giang": [2, 24], "gianni": 17, "giansanti": 13, "giant": 0, "gideon": [36, 51], "gieli": 2, "giga": 24, "gigant": 13, "gigasci": [7, 23, 34], "gil": 7, "gilbert": 1, "gillen": 5, "gillespi": 49, "gillett": [5, 15], "gillich": 7, "gilliland": 5, "gimvi": 38, "gingera": 23, "gioel": [14, 16, 23, 24, 50, 51], "giotti": 7, "giotto": 37, "giovanni": [5, 19, 25, 37, 40, 41], "giraldez": 13, "girk": [19, 22], "girski": 49, "git": [13, 49], "github": [3, 4, 5, 7, 8, 21, 23, 25, 27, 28, 30, 33, 49], "githubusercont": [8, 26], "gitlab": 1, "gittelman": 4, "giulia": 25, "give": [5, 7, 11, 13, 34, 38, 40, 48, 49, 50], "given": [1, 7, 8, 9, 11, 13, 14, 15, 16, 23, 25, 26, 27, 34, 36, 37, 38, 49, 50, 51], "giy059": 23, "gjl": 49, "gkaa740": 38, "gkab004": 7, "gkab043": 36, "gkv007": 14, "gkz204": 25, "gkz562": 9, "gl": [17, 26], "gl000009": 11, "gl000194": 11, "gl000195": 11, "gl000205": 11, "gl000213": 11, "gl000218": 11, "gl000219": 11, "glahn": 13, "glanc": 16, "glanvil": [3, 4], "glass": 18, "glean": 49, "gleb": 7, "gleixner": 15, "glenn": 2, "glib": 13, "glibc2": [1, 25], "glioblastoma": 49, "gliph": 3, "glm": [13, 14], "glmer": 14, "glmgampoi": [31, 32, 33, 34], "glmmtmb": 14, "glmpca": [31, 32, 33, 34], "glmqlfit": 14, "glmqlftest": 14, "glmtreat": 14, "glob": 26, "glob2": [43, 44, 45, 46, 47, 48], "global": [7, 8, 10, 13, 15, 16, 17, 19, 21, 23, 27, 28, 31, 36, 50], "globalenv": [21, 32, 33], "globaloptions_0": [8, 25], "globals_0": [25, 27, 28], "globin": 24, "gloor": 13, "gloria": [2, 5, 43], "glossari": 30, "glue": [7, 21], "glue_1": [8, 25, 27, 28], "gluetmpe8ok569r": 27, "gluetmpx6ds9f5b": 27, "glutam": 24, "glutamaterg": 24, "gm2a": 8, "gmap": 7, "gmean_pval": 25, "gmp": 5, "gmp_0": 8, "gmpr": 14, "gmt": 15, "gmt_to_decoupl": 15, "gn35bga1rt": [11, 27, 28, 34, 48], "gnaq": 5, "gnaz": 38, "gnirk": 24, "gnly": [5, 12], "gnotificationcenterdeleg": 13, "gnu": [8, 25, 27, 28], "gnuplot2": 50, "go": [5, 8, 13, 15, 23, 24, 25, 34, 38, 44, 46, 50], "goal": [7, 16, 34, 49, 50], "goblet": 13, "goe": 19, "goeman": 15, "goettgen": 51, "goeva": 36, "goff": 51, "goffinet": [17, 26], "goftest": [7, 21], "goftest_1": [25, 27, 28], "goh": [7, 50], "goir": [14, 16], "golani": 36, "gold": [23, 26], "goldi": 24, "goldman": [23, 24], "golub": [5, 15], "gome": [5, 23], "gon": [50, 51], "gonad": 25, "gone": 21, "gong": 49, "gonz": [8, 15, 26], "gonzal": 50, "gonzalez": 49, "gonz\u00e1lez": 9, "good": [2, 5, 7, 11, 13, 16, 17, 23, 24, 25, 29, 34, 36, 38, 40, 47, 49], "goodnow": 24, "googl": [1, 5, 7, 31, 40], "gordon": [14, 15, 19, 22], "gorfin": 15, "gorin": 23, "got": [7, 11, 19], "gote": 5, "gottardo": [5, 14, 19, 22, 27, 28, 37, 47, 48], "gould": [7, 49], "gov": 14, "govek": 50, "govern": [49, 51], "govinda": 5, "gower_1": 25, "gp": 8, "gpar": 8, "gpb": 24, "gpl_out_dir": 23, "gplot": [8, 11], "gplots_3": 8, "gpr153": 7, "gpu": [3, 5, 7, 16, 27, 28, 36, 38], "gpu_mod": 28, "gpuallocatorconfig": 5, "gr": [14, 16, 23, 24, 31, 37, 40, 41, 50], "grace": [13, 22, 23, 24], "grade": 26, "gradient": [7, 23, 25, 31, 50], "gradual": 23, "graham": 7, "grain": [16, 36, 43, 50], "granado": [7, 11, 27, 28, 34, 48, 49], "grand": [9, 14], "granda": 27, "grang": 11, "granja": [3, 9], "grant": 7, "granulocyt": 5, "graph": [1, 3, 4, 5, 6, 8, 13, 16, 18, 19, 23, 26, 28, 31, 33, 34, 36, 40, 41, 45, 50, 51], "graph_1": 8, "graph_batch_s": 27, "graph_conn": [7, 28], "graph_conn_": 28, "graph_label": 3, "graph_vs_featur": 3, "graph_vs_graph": 3, "graph_vs_graph_stat": 3, "graphic": [1, 8, 15, 25, 27, 28], "grasp": [30, 45], "grasshoff": [17, 26], "grate": 0, "gratefulli": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 49, 50], "gravelin": 49, "graybuck": 24, "grch38": [23, 36], "grdevic": [8, 15, 25, 27, 28], "greanei": 25, "great": [2, 3, 4, 16, 19, 25, 29, 49], "greater": [2, 7, 21, 22, 33], "greatli": [4, 13, 49], "greedi": [23, 49], "greedili": 23, "greedy_solv": 49, "greedysolv": 49, "green": [7, 23], "greenbaum": 4, "greenleaf": [8, 9, 50], "greg": 14, "gregor": [2, 13, 19, 25], "gregori": [2, 5, 13, 23, 24, 49], "grei": [5, 13], "grepl": 8, "grice": 37, "grid": [8, 37, 39, 40, 41], "grid_4": [15, 25, 27, 28], "gridextra": [7, 21], "gridextra_2": [25, 27, 28], "gridion": 24, "griffant": 43, "grik4": [5, 12], "grime": 23, "grindberg": 24, "grn": 8, "grna": 16, "grnagonzalezbm": 26, "grnboost": 26, "grnfsl": 26, "grngahi": 26, "grnhss": 26, "grnssrp": 26, "grnszsanchezperez": 26, "groblewski": 24, "grosswendt": 49, "grott": 49, "ground": [13, 16, 25, 30, 33, 49], "group": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 15, 16, 17, 18, 19, 24, 25, 26, 27, 28, 33, 36, 37, 39, 41, 43, 48, 49], "group1": 13, "group2": 13, "group_abund": [1, 2], "group_col": [3, 25], "group_field": 1, "group_kei": 14, "group_nam": 14, "group_per_sampl": 17, "group_shuffle_split": 3, "groupbi": [1, 2, 3, 5, 11, 14, 15, 16, 25, 26, 43, 46, 49, 50], "groupctrl": 14, "groupctrl_b_cel": 15, "groupctrl_cd14__monocyt": 15, "groupctrl_cd4_t_cel": 15, "groupctrl_cd8_t_cel": 15, "groupctrl_dendritic_cel": 15, "groupctrl_fcgr3a__monocyt": 15, "groupctrl_nk_cel": 15, "grouper": 11, "grouping_vari": 49, "groups_col": 25, "groups_label": 28, "groupstim": 14, "groupstim_b_cel": 15, "groupstim_cd14__monocyt": 15, "groupstim_cd4_t_cel": 15, "groupstim_cd8_t_cel": 15, "groupstim_dendritic_cel": 15, "groupstim_fcgr3a__monocyt": 15, "groupstim_nk_cel": 15, "grow": [7, 23, 24, 25, 29, 34, 49], "growth": [13, 16, 49], "gruhn": 25, "grunkvo14": 31, "gsea_geneset": 15, "gsea_result": 15, "gseabase_1": 8, "gsl": [27, 28], "gspaagonzalezbm": 15, "gspabimvelezsb": 15, "gspactk": 15, "gspadg04": 15, "gspadj": 15, "gspafranzengbjorkegren19": 15, "gspafsl": 15, "gspagahi": 15, "gspagbuhlmann07": 15, "gspahanzelmanncg13": 15, "gspahs19": 15, "gspahtppaton": 15, "gspaksb": 15, "gspakst": 15, "gspalc": 15, "gspalck": 15, "gspalmm16": 15, "gspalsp": 15, "gsparpw": 15, "gspaskklunemann": 15, "gspasmy05": 15, "gspastm": 15, "gspazlx": 15, "gspazmh": 15, "gsub": [15, 21], "gsva": 15, "gt": [10, 14], "gtaaccatcggagtga": 28, "gtabl": [7, 21], "gtable_0": [8, 25, 27, 28], "gtagaaagtgacacag": [27, 28], "gtcaagtcaaggactg": 3, "gtcgtaatcaccgtaa": 3, "gtf": 23, "gtf_file": 23, "gtg": 24, "gtgcagcgtctcccta": 3, "gtggttagtcgagttt": 28, "gtools_3": 8, "gttgtggcccaacatggcagcgtgccgtagcttagttgtcaggccatttgctgg": 49, "gtttatttccgtatr3": 49, "gu": [37, 51], "guangyao": 37, "guanin": 18, "guarante": [5, 6, 19, 23, 26, 50], "guenthoer": 37, "guerrero": 25, "guess": 5, "gui": [2, 13, 16], "guibentif": 51, "guid": [0, 3, 7, 8, 9, 14, 16, 22, 23, 24, 26, 27, 28, 30, 34, 48, 49], "guide_id": 16, "guide_legend": 8, "guide_rna_column": 16, "guidebook": 39, "guidelin": [4, 7, 22, 24, 49], "guilin": [7, 11, 27, 28, 34, 48], "guillaum": [6, 50], "guillaumet": 24, "guinnei": 15, "guion": 3, "gummert": 36, "guna": 16, "gunilla": 1, "gunzip": 23, "guo": [4, 5, 7, 36, 37, 38, 49, 50, 51], "guohao": 49, "gupta": [1, 23, 24], "gur": 1, "guryev": 14, "gus91": 49, "gusfield": 49, "gut": [24, 36], "gutierrez": [5, 7, 50], "guttorp": 40, "gvhu": 1, "gwendolyn": 15, "gypa": [5, 12], "gz": [10, 11, 19, 23, 49], "gzip": 19, "gzma": [5, 12], "gzmb": [5, 12], "gzmh": [5, 12], "gzmk": [5, 12], "g\u00f6ttgen": 6, "h": [1, 3, 5, 7, 13, 14, 15, 16, 17, 22, 23, 24, 25, 26, 36, 37, 43, 49, 50], "h2": 25, "h5": [3, 10, 11, 19, 34, 48], "h5ad": [1, 2, 3, 4, 5, 6, 7, 10, 11, 15, 17, 18, 19, 25, 26, 27, 28, 31, 32, 33, 34, 36, 38, 43, 49, 50, 51], "h5ad_fil": 21, "h5group": 21, "h5l": 19, "h5mu": [10, 19, 21, 44, 45, 46, 47, 48], "h5py": [1, 7, 15, 21, 25], "h5seurat": 21, "h5seurat_fil": 21, "ha": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, 36, 37, 38, 41, 48, 49, 51], "haan": 49, "haas": 24, "haber": [7, 13, 22], "haber_2017_region": 13, "habermann": 7, "hach": 23, "hacohen": 24, "had": [7, 10, 15, 16, 49], "hada": 36, "haegeman": 24, "hafemeist": [7, 15, 16, 47, 48, 50], "hafler": 1, "hagemann": 23, "hagen": 24, "haghverdi": [7, 50, 51], "hagood": 5, "hahn": [19, 22], "hai": [13, 22], "haider": [2, 19], "haig": 23, "hailiang": 5, "haitao": 37, "haiyan": 25, "haiyang": 48, "hajim": 23, "halder": 36, "half": [19, 37, 49, 51], "hall": 40, "hallmark": 15, "halperin": 23, "haltal": 50, "ham": [18, 23], "hamazaki": 49, "hame": 23, "hamei": [6, 50], "hamish": [36, 50], "hammel": 3, "han": [2, 3, 4, 14, 15, 16, 17, 26, 37, 49, 50], "hana": [15, 26], "hananeh": [7, 11, 17, 27, 28, 34, 48], "hand": [1, 4, 7, 9, 14, 17, 23, 24, 25, 26, 28, 36, 38, 40, 49, 51], "handbook": 40, "handi": 24, "handl": [1, 3, 7, 10, 18, 21, 23, 24, 36], "handler": 27, "handong": 5, "handwritten": 16, "hang": 40, "hanha": 26, "hani": 9, "haniffa": [2, 25, 50], "hanjani": 49, "hankeln": 23, "hannah": [5, 14, 16, 19, 37, 40, 41, 50, 51], "hannani": 36, "hanrui": 49, "hansen": [19, 22, 51], "hansi": 25, "hao": [5, 7, 14, 16, 19, 27, 28, 36, 37, 38, 48, 49, 50], "haorong": 37, "haoyan": 37, "happen": [7, 11, 16, 23, 25, 26, 36, 48], "harbor": 2, "hard": [5, 24, 26, 29, 34, 45, 48], "hardhat_1": 25, "hardwar": 26, "hardwork": 0, "harind": 23, "harismendi": 25, "harm": [2, 24], "harmon": [5, 9, 11, 16], "harmoni": [7, 28], "harmony_pca": [27, 28], "harmonypi": [43, 44, 45, 46, 47, 48], "harold": [16, 23, 47, 48, 50], "harri": 24, "hartigan": 49, "hartman": 27, "harvei": [7, 23], "harvest": 49, "has_ir": [2, 3, 4], "has_vdjdb_overlap": 4, "hash": [10, 16, 17, 34], "hashtag": 16, "hat": 36, "hata": [48, 50], "hatti": 7, "hatton": [3, 4], "hauser": 4, "hauser_ab15": 4, "hauser_ab16": 4, "hauser_ab17": 4, "hauser_ab19": 4, "have": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "havenar": 2, "hawrylycz": 24, "hayashi": 24, "hayat": 36, "hayden": 24, "hazard": 2, "hb": [17, 34], "hba1": [5, 12], "hba2": [5, 12, 26], "hbb": [5, 12, 24], "hbc": 23, "hbm": [5, 12], "hc": [4, 38], "hcv": 4, "hdf5": [19, 28], "hdf5r": 21, "hdi": 13, "hdim": 3, "hdo": 25, "hdst": 39, "he": [5, 7, 23, 24, 49, 50, 51], "head": [2, 3, 4, 10, 11, 14, 15, 19, 21, 25, 26, 36, 41, 48, 49], "header": [4, 19], "health": [5, 7, 19, 24, 50], "healthi": [1, 2, 3, 5, 13, 14, 15, 17, 19, 26, 28, 29, 34, 48], "healthy_sampl": 13, "healthy_tissu": 13, "healty_vs_covid": 17, "heather": [24, 49], "heatmap": [1, 4, 8, 14, 16, 25, 26, 49], "heatmap_cat": 1, "heavi": [1, 2, 3, 4, 24, 49], "heavili": [2, 4, 6, 16, 30, 34, 49], "hebenstreit": 24, "hechen": 49, "hector": [19, 22], "hedestam": 1, "hediyeh": [14, 15], "heger": 23, "heiden": 1, "height": [3, 8, 15, 42], "heiko": [7, 11, 27, 28, 34, 48, 51], "heim": [17, 26], "heimberg": 7, "hein": [17, 26], "heinrich": 24, "heinzlmeier": 24, "heiser": 23, "heladia": 26, "held": 16, "helen": [23, 49], "helga": 15, "heligmosomoid": 13, "heller": 13, "hellmann": [23, 24], "hellmuth": 17, "helmholtz": 30, "helminth": 13, "help": [0, 1, 3, 4, 5, 6, 7, 8, 11, 13, 16, 19, 21, 23, 24, 26, 27, 30, 33, 36, 38, 40, 41, 45, 48, 49, 50, 51], "helper": [5, 14, 23, 25, 27], "helpfulli": 7, "hemato": 17, "hematologi": 49, "hematopoiesi": [5, 49], "hematopoiet": [1, 5, 38, 49, 50], "hemberg": 7, "hemoglobin": [24, 34], "hemoglobulin": 5, "henao": 1, "henc": [1, 3, 5, 6, 8, 13, 14, 15, 16, 19, 24, 25, 26, 27, 28, 32, 34, 36, 37, 38, 40, 44, 49], "henceforth": [24, 50], "henderson": [13, 49, 50], "hendrickson": 23, "hendrik": [23, 36], "heng": 23, "hengwei": 49, "henikoff": 4, "hennig": 50, "henri": 13, "henrik": [7, 17, 26], "heonjong": 26, "herbert": [5, 7, 17, 25, 26, 50, 51], "herbst": [13, 22], "herc6": 25, "here": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 38, 40, 41, 44, 48, 49, 50, 51], "here_1": 8, "herebi": [13, 25], "hereditari": [18, 24], "herit": 49, "herman": 15, "hermann": [16, 23], "herold": 13, "herrig": 49, "hertz": [3, 4], "herv": [19, 22], "hes4": 3, "hesselberth": 5, "hession": 24, "hesx1": 14, "heterochromatin": 9, "heterogen": [1, 7, 14, 15, 17, 21, 23, 24, 30, 32, 33, 49, 50], "heteromer": 25, "heterotyp": [11, 34, 46], "hetzel": [5, 36, 38], "hetzer": 9, "heumo": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "heurist": [7, 23, 33, 49], "heutink": 17, "hewitson": 5, "heyn": [15, 24, 36, 39], "hg19": 8, "hg38": [8, 10, 11, 26], "hg38_1": 8, "hg38__refseq": 26, "hgnc": 26, "hh92": 4, "hh_s5f": 1, "hhan": [27, 28], "hi": [5, 8, 12, 24], "hick": [14, 22, 23, 32], "hickei": [21, 23], "hidden": [16, 24, 37, 42], "hide": [9, 24], "hideto": 49, "hie": 7, "hierarch": [1, 4, 19, 21, 36, 49, 50], "hierarchi": [3, 4, 5, 13, 21, 50], "high": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 29, 31, 32, 34, 36, 37, 40, 46, 49, 50, 51], "high_confid": [1, 2], "higher": [1, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 31, 34, 37, 46, 49, 50, 51], "highest": [1, 5, 7, 11, 14, 16, 17, 19, 23, 25, 28, 31, 34, 37], "highest_expr_gen": 19, "highli": [1, 2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 29, 31, 32, 38, 41, 43, 49, 50, 51], "highlight": [1, 3, 5, 6, 9, 13, 14, 16, 22, 23, 25, 26, 33, 34, 39, 49], "highly_devi": [5, 31, 32], "highly_vari": [3, 5, 7, 13, 15, 17, 21, 26, 27, 28, 31, 37], "highly_variable_gen": [3, 7, 13, 15, 16, 17, 19, 21, 26, 32, 50, 51], "highly_variable_intersect": 7, "highly_variable_nbatch": 7, "highly_variable_rank": [15, 37], "highs_wrapp": 1, "hill": 23, "hindson": [23, 24], "hint": [1, 36], "hippen": 23, "hippenstiel": [17, 26], "hirak": [23, 51], "hire": 36, "hiroaki": 49, "hirokawa": 24, "hirsch": 51, "hirschstein": 24, "hist": [13, 26], "histocompat": 2, "histogram": [4, 11, 13, 19, 23, 26, 36], "histolog": [36, 37], "histologi": [36, 41], "histon": 9, "histori": [36, 49], "histplot": [4, 11, 33], "hit": [4, 23, 49, 50], "hiv": 4, "hj": [23, 51], "hla": [4, 25, 27, 45], "hla_dqb1": 25, "hle": 7, "hler": 25, "hll": 49, "hlmann": 15, "hm": 44, "hmac": 2, "hmgb1": 25, "hmgb2": 26, "hmisc": 25, "hmisc_4": 25, "hmrf": 37, "hms_1": [8, 25], "hnemann": 14, "ho": [3, 4, 16, 23, 44, 49], "hoa": 7, "hoc": [13, 23], "hochberg": [13, 14], "hochgern": [50, 51], "hock": [17, 26], "hodg": 24, "hoeft": 36, "hoern": 29, "hofbauer": 5, "hoffman": [5, 7, 14, 19, 27, 28], "hoi": [23, 49, 51], "hold": [7, 19, 51], "holger": [15, 17, 24, 26, 36, 39], "holist": 28, "holland": [15, 26], "hollei": 24, "holm": 25, "holmberg": [19, 37, 40, 41], "holmer": 14, "home": [1, 2, 4, 5, 8, 10, 19, 25, 36, 37, 41, 49, 50], "homeostasi": [24, 25], "homo": 4, "homo_sapien": 26, "homogen": [17, 19, 24], "homolog": 24, "homologi": 4, "homosapien": 4, "homotyp": [11, 34], "honei": [7, 11, 27, 28, 34, 48], "honeycomb": 24, "hong": [7, 37, 51], "hongbo": 2, "hongkai": 49, "hongkui": [5, 24], "honglei": [39, 41], "hongseok": 26, "hongyu": 3, "hood": 24, "hoogduin": 5, "hoogenboezem": 36, "hook": [24, 28], "hooshiar": [5, 7, 50], "hop": 23, "horizont": [11, 19], "horizontal_gap": 36, "horkova": 43, "hormoz": 49, "horn": [17, 26], "horsfal": 50, "horvath": [5, 13], "horwitz": 49, "host": [2, 23, 24, 34, 49, 50], "hou": [7, 9, 25], "houck": [16, 47, 48, 50], "hour": [11, 16], "hover": 42, "how": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 39, 40, 41, 44, 48, 49, 50, 51], "howard": [9, 50], "howev": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 34, 37, 38, 39, 41, 43, 48, 49, 50, 51], "howitt": [13, 22], "howlett": 5, "hpca": 17, "hpgt21": 25, "hpoli": 13, "hpoly_timecours": 13, "hpu": [5, 7, 16, 27, 28, 36], "hratch": 25, "hrdlickova": 24, "hrnb01": 49, "hsapien": [8, 10, 11], "hsc": [5, 7, 12, 38], "hsc_1": 50, "hsc_2": 50, "hsiang": 25, "hsk": 27, "hsp90b1": [5, 12], "hspc": 12, "hstack": 19, "hsv": 4, "html": [1, 3, 5, 6, 15, 16, 19, 21, 23, 27, 28, 42, 50], "html5": 15, "html_code": 42, "htmltable_2": 25, "htmltool": [7, 21], "htmltools_0": [8, 25, 27, 28], "htmlwidget": [7, 21], "htmlwidgets_1": [8, 25, 27, 28], "hto": 16, "hto_classif": [16, 17], "hto_margin": 17, "hto_maxid": 17, "hto_secondid": 17, "http": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "httpuv": [7, 21], "httpuv_1": [8, 25, 27, 28], "httr": [7, 21], "httr_1": [8, 25, 27, 28], "hu": [2, 7, 8, 14, 15, 17, 25, 36, 37, 38, 39, 41, 49, 50], "hua": 25, "huachen": 5, "huan": [14, 25, 49], "huang": [3, 4, 5, 7, 13, 15, 23, 24, 37, 39, 48, 49, 50, 51], "huanm": 37, "huat": 37, "huber": [14, 19, 22, 33], "hudel": [14, 16], "hue": [13, 16, 32, 38, 48], "huelsenbeck": 49, "hufnagel": 7, "huge": [24, 25], "hugh": 24, "hughei": 23, "hugo": 5, "hui": [37, 49], "huidong": 11, "huifang": 37, "huipeng": 37, "huiwen": 37, "hulselman": [8, 9, 15, 26], "hum": 49, "human": [1, 2, 3, 4, 5, 7, 9, 10, 16, 17, 19, 23, 24, 25, 26, 28, 30, 34, 36, 40, 45, 48, 49, 51], "humantf": 8, "humphrei": 23, "hundr": [16, 23, 24, 38, 45, 48], "hunkapil": 24, "hurlei": 49, "hussain": 50, "hussmann": [16, 49], "hutson": [14, 16], "hutzenlaub": 23, "huynh": [7, 11, 15, 26, 27, 28, 34, 48], "hvg": [7, 13, 15, 17, 21, 26, 27, 28, 37, 41], "hvg_overlap": [7, 28], "hwan": [47, 48], "hwang": [17, 50, 51], "hybrid": [18, 24, 25, 38, 49], "hybridsolv": 49, "hydrogel": 24, "hydrogen": 24, "hyeon": 26, "hyoj": 17, "hyojin": [25, 26], "hypergeom_ufunc": [7, 15, 21, 25], "hypergeometr": 15, "hypermut": [1, 2, 4], "hyperparamet": [3, 36, 49], "hypothalamu": 41, "hypothes": [1, 25, 37, 51], "hypothesi": [11, 13, 15, 16, 25], "hyun": [14, 15, 16, 25, 50], "hyung": 2, "hzxd16": 2, "i": [0, 1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 12, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "i1": 7, "i192": 23, "i200": 23, "i386": [7, 15, 21], "i610": 16, "i617": 16, "iain": [24, 30], "ian": [4, 7, 23, 24, 51], "ibarra": [5, 7, 8, 16, 19, 26, 37, 40, 41, 50], "ibrahim": [15, 23, 26], "ic50": 16, "ica": [7, 21], "ica_1": [25, 27, 28], "icam1": [25, 27], "icb": [1, 4, 5, 10, 36, 37, 41], "ico": [27, 48], "icoresi": 25, "id": [1, 2, 3, 4, 5, 11, 15, 16, 17, 19, 26, 27, 28, 31, 34, 40, 42, 48], "id2": [5, 12], "ida": 2, "idea": [2, 5, 7, 11, 13, 16, 19, 21, 22, 24, 25, 38, 47], "ideal": [5, 11, 13, 15, 23, 24, 25, 36], "idek": [15, 49], "ident": [1, 2, 3, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 33, 38, 39, 48, 49, 50], "identif": [1, 4, 5, 6, 11, 14, 15, 16, 18, 23, 24, 26, 33, 34, 36, 37, 40, 41, 43, 48, 49], "identifi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 18, 19, 23, 24, 25, 26, 31, 32, 34, 36, 37, 38, 41, 42, 43, 46, 48, 49, 50, 51], "identncount_rnanfeature_rnancount_atacnfeature_atacncount_gene_activitynfeature_gene_activityn_features_per_celltotal_fragment_countslog_total_fragment_count": 10, "idf": [27, 28], "idiosyncrat": 23, "idna": [1, 21], "ido": [4, 36, 50], "ids2indic": 15, "idx": [15, 32], "idx_atac_queri": 27, "idx_cite_queri": 27, "idx_mutiome_queri": 27, "idx_out_dir": 23, "idx_scrna_queri": 27, "iedb": 4, "ieee": 50, "ifels": 14, "ifgn": 16, "ifgnr2": 16, "ifi16": 25, "ifi6": [16, 25], "ifih1": 25, "ifit1": 25, "ifit2": 25, "ifit3": 25, "ifitm3": 15, "ifn": [15, 25], "ifn_pathwai": 15, "ifng": 3, "ifngr1": 16, "ifngr2": 16, "ifram": 3, "ig": [1, 2, 36], "iga": 5, "igd": [12, 27], "igg": 1, "igg1": [45, 47], "igg2a": [45, 47], "igg2b": [45, 47], "igh": [1, 2], "igha1": 2, "ighd": [2, 5, 12, 27], "ighd2": 2, "ighd3": 2, "ighd5": 2, "ighg1": 2, "ighj4": 2, "ighj5": 2, "ighj6": 2, "ighm": [2, 5, 12, 27], "ighv1": [1, 2], "ighv3": [1, 2], "ighv5": 2, "igkc": [2, 5, 12], "igkj1": 4, "igkj2": 4, "igkj3": 2, "igkv1": 2, "igkv3": 2, "igkv6": 2, "igl": 2, "iglc1": 2, "iglc2": 2, "iglc3": 2, "iglj1": 2, "iglj3": 2, "iglj5": 2, "igll1": [5, 12], "iglv1": 2, "iglv3": 2, "iglv4": 2, "igm": [1, 27, 45], "ignacio": [5, 7, 8, 16, 19, 26, 37, 40, 41, 50], "ignati": 49, "ignit": 27, "ignor": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 23, 25, 26, 27, 28, 36, 47], "ignore_index": 7, "igo": 23, "igor": [50, 51], "igraph": [1, 6, 7, 19, 21], "igraph_1": [8, 25, 27, 28], "ihc": 39, "ii": [4, 49], "iii": [14, 19, 49], "ij": 38, "ik": 38, "il": 49, "il1rn": 14, "il2ra": 27, "il2rb": 27, "il3ra": [5, 12], "il4r": [5, 12, 27], "il6st": 15, "il7r": [5, 12, 27], "ilc": [5, 7, 12], "ilc1": [5, 12], "ilc2": 5, "ilc3": 5, "ilia": [1, 7, 19, 23, 41, 48], "ilisi": [7, 28], "ilk": 24, "ill": 2, "illinoi": 9, "illumina": [2, 19, 23, 24], "illustr": [1, 9, 13, 15, 23, 37], "iloc": [5, 19], "ilpsolv": 49, "ilya": [5, 7, 44], "im": 8, "imag": [1, 8, 11, 16, 19, 23, 24, 26, 36, 37, 38, 39, 49], "imager_0": 8, "imagin": [0, 7, 19, 49], "imaz": 51, "imbal": 13, "imc": 39, "img": 37, "img_kei": 36, "imit": 27, "immatur": 17, "immcant": 1, "immedi": [1, 31], "immens": 2, "immobil": 2, "immun": [1, 3, 4, 5, 9, 13, 16, 17, 18, 43, 48, 50], "immunarch": 2, "immune_all_high": 5, "immune_all_low": 5, "immunecod": 4, "immunis": 4, "immunodomin": 1, "immunogen": 4, "immunogenet": 17, "immunoglobulin": [1, 2], "immunoinformat": 2, "immunolog": [1, 15], "immunologi": [1, 2, 4, 17], "immunomagnet": 2, "immunomind": 2, "immunomindteam19": 2, "immunoprecipit": 25, "impact": [6, 9, 13, 15, 17, 33, 37, 49], "imper": 49, "imperfect": [5, 23], "implaus": 23, "implement": [1, 2, 4, 6, 8, 11, 13, 14, 15, 16, 19, 21, 23, 25, 31, 33, 40, 41, 47, 48, 49, 51], "impli": [4, 23, 25, 33], "implic": [5, 13, 15, 24, 49], "implicitmodificationwarn": [1, 4, 25], "import": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "import_builtin": 21, "important_featur": 16, "importantli": [5, 8, 19, 25, 49], "importlib_metadata": [7, 15, 21], "importlib_resourc": [1, 21], "imposs": [3, 13, 16, 49, 50], "impract": 21, "imprecis": 1, "impress": 5, "improv": [1, 3, 5, 6, 7, 9, 11, 14, 15, 16, 17, 21, 23, 25, 27, 28, 30, 33, 43, 48, 49, 51], "imput": [18, 28], "imrichova": [15, 26], "in_tissu": [36, 37], "inabl": 13, "inaccur": [16, 18, 23, 26], "inaccuraci": [4, 14, 23], "inadequ": 15, "inanim": 24, "inapplic": 51, "inappropri": 48, "inbal": [7, 38], "inbuilt": 21, "incid": 23, "inclin": 38, "includ": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 41, 43, 48, 49, 50, 51], "include_ref_col": 4, "inclus": [13, 23, 25], "incompat": 46, "incomplet": [2, 4, 23, 26, 48], "inconsist": [7, 15, 21, 38], "incorpor": [4, 5, 7, 13, 18, 23, 24, 26, 28, 34, 36, 37, 49], "incorrect": [2, 23, 42, 51], "incorrectli": 49, "increas": [1, 3, 4, 7, 8, 13, 14, 16, 18, 23, 24, 25, 26, 32, 36, 38, 40, 43, 46, 48, 49, 50], "increasingli": [3, 29], "ind": 15, "ind_x": 36, "inde": [14, 15, 16, 17, 40], "indel": 49, "indel_prior": 49, "independ": [1, 3, 4, 5, 9, 13, 14, 15, 16, 18, 19, 22, 23, 25, 26, 30, 31, 33, 36, 38, 49, 51], "inderbitzin": 2, "index": [1, 2, 3, 4, 5, 8, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 33, 34, 36, 37, 41, 45, 46, 48, 49, 51], "index_cel": 13, "index_col": [2, 3, 4, 5, 17, 26, 49], "index_dir": 23, "index_not_tf": 8, "index_tf": 8, "index_uniqu": 5, "indic": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 28, 32, 33, 34, 36, 38, 40, 41, 49], "indistinguish": 24, "individu": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 19, 22, 23, 24, 25, 26, 30, 34, 36, 38, 39, 48, 49, 50, 51], "indptr": 15, "indrop": [18, 24], "indu": 14, "induc": [7, 8, 13, 14, 16, 24, 25, 49], "induct": [16, 25, 49, 51], "inecik": 5, "ineffici": 13, "inen": 23, "inevit": 29, "inf": [14, 16, 25], "inf_av": 36, "infarct": 36, "infect": [1, 3, 4, 13, 24], "infecti": 2, "infer": [2, 3, 4, 5, 6, 7, 9, 13, 14, 16, 17, 18, 19, 23, 26, 27, 34, 36, 38], "inferenti": 14, "inflammatori": [2, 3], "inflat": [5, 14, 16, 23, 50], "inflect": 23, "inflict": 16, "influenc": [1, 3, 4, 6, 8, 9, 13, 15, 16, 17, 23, 24, 26], "influenzaa": 4, "info": [5, 6, 7, 13, 14, 21, 28, 31, 32, 33, 34, 36, 38, 44], "inform": [1, 2, 3, 4, 5, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 34, 36, 37, 38, 39, 43, 44, 45, 48, 49, 50, 51], "infrequ": 23, "ingo": 51, "ingraham": 16, "inhal": 49, "inher": [3, 5, 13, 14, 15, 23, 30, 31, 51], "inherit": [2, 24], "inhibit": [8, 18], "inhibitor": 2, "inhibitori": 16, "inigo": 49, "initi": [1, 2, 3, 5, 6, 11, 13, 14, 17, 18, 21, 22, 23, 25, 26, 27, 28, 31, 34, 37, 44, 50], "initial_clust": [1, 2, 4], "inject": 26, "inlin": 42, "innat": 1, "inner": 42, "innerhtml": 42, "innocu": 34, "innov": 24, "inplac": [1, 5, 11, 16, 19, 21, 25, 33, 34, 36, 48], "input": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 33, 34, 36, 37, 42, 47, 49], "input_data": 3, "input_group": 33, "input_sequ": 4, "inquiri": 30, "inscrib": 49, "insert": [2, 9, 18, 19, 23, 49], "insid": [1, 2, 11, 15, 18, 19, 23, 24], "insight": [2, 3, 5, 9, 13, 15, 17, 18, 23, 25, 26, 34, 49, 50], "inspect": [5, 6, 7, 8, 14, 16, 26, 32, 33, 34, 36, 37, 38, 41], "inspir": [13, 19, 22], "instabl": [4, 49], "instal": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "install_github": [8, 21, 25, 27], "instanc": [1, 11, 19, 21, 23, 26, 27, 28, 41, 50], "instantan": 24, "instanti": [13, 49], "instead": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 15, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 34, 36, 38, 41, 47, 50, 51], "institut": 49, "instruct": [3, 18, 23, 30, 50], "instrument": [19, 24], "instrument_typ": 19, "insuffici": 23, "insuk": 26, "int": [2, 4, 7, 10, 13, 15, 26, 34, 42, 48], "int64": [1, 2, 4, 5, 7, 11, 16, 17, 26, 34, 47], "intacsm21": 7, "intact": 34, "intbh": 7, "intbuttnermw": 7, "intcgvdkh21": 7, "integ": [7, 19, 27, 34], "integr": [2, 4, 5, 9, 11, 13, 14, 15, 17, 18, 19, 23, 25, 26, 29, 30, 34, 36, 38, 41, 44, 47, 48, 49, 50], "integrate_on": 27, "integrated_expr": 7, "integrated_snn_r": [14, 15, 16, 25], "integratedata": [7, 28], "integration_introduct": [27, 28], "integrinb7": 12, "intel": 23, "intellig": 3, "intend": 25, "intens": [5, 16, 23, 24, 37], "intent": 36, "inter": [15, 17, 25], "interact": [2, 3, 4, 8, 15, 16, 17, 18, 19, 21, 24, 26, 37, 42], "interaction_matrix": 40, "intercept": 13, "intercept_df": 13, "interchang": [7, 15], "interdepend": 3, "interest": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 18, 22, 23, 24, 26, 27, 28, 30, 34, 36, 37, 38, 39, 40, 48, 49], "interestingli": [13, 37], "interf": 18, "interfac": [2, 4, 7, 17, 21, 23], "interfer": [18, 23], "interferon": [3, 14, 15], "intergen": 18, "interlandi": [5, 7, 28], "interlink": [3, 16], "intermedi": [5, 11, 14, 23, 24], "intermix": 44, "intern": [3, 4, 7, 13, 17, 19, 23, 49], "interneuron": 24, "interoper": 19, "interoperability2": 21, "interoperabilti": 21, "interp_1": 25, "interplai": [9, 25], "interpret": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 23, 25, 28, 31, 34, 41, 51], "interquartil": 23, "interrog": 49, "intersect": [2, 5, 19, 25, 27, 28, 38], "intersect1d": 17, "intersect_ob": 19, "interspers": 11, "interv": [10, 11, 13, 18, 19, 34, 36, 40], "intestin": [5, 13, 22], "intglx": 7, "inthbb19": 7, "inthlmm18": 7, "intjlr07": 7, "intkmf": 7, "intlbc": 7, "intlbuttnerc": 7, "intllb": 7, "intlrc": 7, "intlt19": 7, "intlwt19": 7, "intmemoir": 49, "intml": 7, "intpolanskipi": 7, "intpzo17": 7, "intra": [6, 17, 25], "intracellular": [25, 48], "intract": 36, "intratumor": 49, "intraven": 2, "intrigu": [3, 48], "intrins": [7, 16], "introduc": [2, 4, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 30, 32, 33, 34, 36, 39, 41, 48, 49], "introduct": [1, 10, 19, 22, 25, 34, 39, 49], "intron": [18, 23, 51], "intsbh": 7, "intsfg": 7, "intsfhm21": 7, "intssz": 7, "inttac": 7, "intuit": [8, 23, 50], "intvdbsvertesi": 7, "intwkl12": 7, "intxlm": 7, "invad": 2, "invalid": [1, 13, 17, 23], "invalid_argu": 5, "invers": [3, 19, 25], "inverse_colour": 25, "inverse_s": 25, "invert": 1, "investig": [3, 14, 16, 23, 24, 38, 49, 51], "invgauss_ufunc": 25, "invis": 5, "invit": [30, 37], "involv": [1, 4, 5, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 30, 32, 34], "inzani": 51, "io": [2, 5, 6, 7, 15, 19, 21, 27, 28, 49, 50], "ioana": 2, "ioanni": 1, "ion": [14, 24], "iona": 47, "iop": 6, "ippolito": 3, "ipred_0": 25, "iprogress": [1, 2, 3, 4, 5, 6, 15, 50], "ipu": [5, 7, 16, 27, 28, 36], "ipykernel": [1, 7, 15, 21, 25], "ipykernel_65366": 49, "ipynb": 50, "ipython": [1, 3, 7, 11, 14, 15, 17, 21, 25, 27, 28, 32, 33, 34, 42], "ipython_genutil": [1, 7, 21, 25], "ipywidget": [1, 5, 6, 7, 15, 21, 25, 50], "ir": [1, 3, 4], "ir_dist": [1, 4], "ir_dist_aa_": 4, "ir_queri": 4, "ir_query_annot": 4, "ir_v": 2, "ir_vdj_1_c_cal": 2, "ir_vdj_1_d_cal": 1, "ir_vdj_1_j_cal": 4, "ir_vdj_1_junction_aa": [1, 3, 4], "ir_vdj_1_product": 2, "ir_vdj_1_v_cal": [1, 2, 4], "ir_vdj_1_v_cigar": 4, "ir_vdj_2_c_cal": 2, "ir_vdj_2_junction_aa": 4, "ir_vdj_2_locu": 2, "ir_vdj_2_product": 2, "ir_vdj_2_sequence_id": 4, "ir_vdj_2_v_cal": [2, 4], "ir_vdj_2_v_cigar": 4, "ir_vj_1_c_cal": 2, "ir_vj_1_consensus_count": 2, "ir_vj_1_h_cal": 4, "ir_vj_1_j_cal": 4, "ir_vj_1_junction_aa": [1, 3, 4], "ir_vj_1_product": 2, "ir_vj_1_v_cal": [1, 2, 4], "ir_vj_1_v_cigar": 4, "ir_vj_2_c_cal": 2, "ir_vj_2_consensus_count": 2, "ir_vj_2_junction_aa": 4, "ir_vj_2_product": 2, "ir_vj_2_v_cal": [2, 4], "ir_vj_2_v_cigar": 4, "irang": [7, 11, 21], "iranges_2": [8, 15, 25, 27, 28], "irdisplay_1": 8, "iren": [23, 50], "irepan": 49, "irf1": 16, "irf4": [5, 12], "irf7": 25, "irizarri": [14, 19, 22, 32, 36], "irkernel": [8, 11], "irkernel_1": 8, "irlba": [7, 21], "irlba_2": [25, 27, 28], "iroot": 50, "irregular": 23, "irwin": [37, 41], "is_cel": [1, 2], "is_fil": 15, "is_latest": 50, "is_outli": [34, 48], "is_tf": 8, "is_train": [27, 28, 38], "is_view": 19, "isaac": [15, 19, 21, 37, 40, 41, 50], "isabella": 51, "isacco": [7, 11, 27, 28, 34, 48], "isback": 19, "isbel": 9, "isbn": 40, "isg15": [3, 15, 16], "isg20": 16, "ishaan": 24, "ishaqu": 40, "ishiguro": 49, "isin": [1, 2, 3, 4, 5, 7, 15, 17, 19, 25, 26, 27, 28, 45, 49], "isinst": 15, "islam": [23, 24, 50], "island": [16, 18, 24], "isn": 7, "isna": [3, 4], "isnan": 17, "isodur": 21, "isoform": 24, "isol": [7, 11, 23, 24, 28], "isolated_label_f1": [7, 28], "isolated_label_silhouett": [7, 28], "isolated_labels_asw_": 28, "isometr": 13, "isotyp": [1, 45, 47, 48], "isotype_control": [45, 47], "isotype_statu": 1, "isr": 23, "issac": 50, "isspars": 33, "issu": [4, 7, 11, 13, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 30, 33, 36, 39], "itai": [13, 17, 22, 23, 24, 49], "item": [3, 5, 7, 15, 19, 21, 41, 42], "iter": [3, 7, 8, 11, 15, 16, 42, 44, 49], "iterators_1": [8, 25], "iteritem": 15, "iterrow": 7, "itertool": [15, 17], "itga": 27, "itga1": 27, "itga2b": [5, 12], "itga6": 27, "itgam": 27, "itgax": 27, "itgb1": [5, 12, 27], "itgb2": 25, "itoshi": 24, "its": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 13, 16, 19, 21, 22, 23, 24, 25, 34, 36, 37, 38, 41, 49, 50, 51], "itself": [1, 6, 7, 13, 16, 19, 23, 25, 36, 38, 50, 51], "itu_intub": 2, "itu_o2": 2, "iv": 49, "ivan": [4, 7, 25, 36, 51], "ivi": 23, "ivlp": 4, "ivo": [24, 36], "iwo": 50, "j": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "j_": 2, "j_call": 1, "j_call_b_vdj": 1, "j_call_b_vj": 1, "j_call_vdj": 1, "j_call_vj": 1, "j_cigar": 1, "j_field": 1, "j_gene": 2, "jaakkola": 14, "jabbari": 23, "jaccard": 1, "jacinta": 9, "jack": 49, "jackson": [5, 7, 13, 16, 24, 50], "jacob": [3, 4, 17, 23, 26, 50, 51], "jacqu": 11, "jae": 25, "jafar": 23, "jaff": [13, 24], "jagadeesh": 7, "jahn": 14, "jai": [5, 13, 23, 49], "jaim": 4, "jain": [5, 7, 14, 19, 24, 27, 28, 36, 50], "jaison": [5, 14, 19, 27, 28], "jaiswal": 7, "jak2": [15, 16], "jakmip1": 12, "jakob": 24, "jamal": 49, "jame": [2, 5, 14, 16, 19, 22, 23, 24, 25, 26, 36, 48, 49, 50], "jami": [5, 37], "jamison": 24, "jan": [1, 5, 14, 15, 16, 17, 23, 24, 25, 26, 28, 36, 37, 49, 50], "jana": [15, 37], "janbandhu": 23, "jane": 50, "janin": [5, 7, 50, 51], "janjic": 24, "janjuha": 49, "januari": [7, 26, 41, 50, 51], "jarci": [17, 26], "jardin": 50, "jarosch": 3, "jarvi": 5, "jase": [23, 51], "jasmijn": 14, "jasmin": 51, "jason": [1, 4, 5, 8, 11, 14, 23, 24, 37, 38, 50], "jasper": [8, 9, 26], "jaum": 50, "javier": [15, 49], "jax": [7, 16], "jaxlib": [5, 7], "jayaraj": [5, 7, 50], "jayasuriya": 7, "jc": 49, "jchain": [5, 12], "jdb_palett": 8, "je": 15, "jean": [6, 7, 13, 15, 26, 37, 44, 49, 50, 51], "jeana": 9, "jeann": [5, 7, 50], "jedi": [1, 7, 15, 21, 25], "jeff": 24, "jeffrei": [3, 5, 7, 9, 16, 27, 28, 38, 39, 44, 49, 50], "jelinski": 36, "jell": 15, "jen": 2, "jeng": 50, "jennif": [4, 8, 13, 17, 23, 24, 38, 48, 49, 51], "jensen": 23, "jeopardi": 48, "jerald": [23, 24], "jerbi": 16, "jerelyn": 48, "jeremi": [3, 4, 24], "jeroen": 14, "jerold": 15, "jess": 5, "jessen": 4, "jessica": [5, 7, 16, 23, 24, 34], "jessurun": 14, "jesu": 5, "jew": 23, "jgjz": 25, "jha": 23, "ji": [3, 4, 5, 7, 16, 37, 49, 50], "jia": [7, 11, 27, 28, 34, 48], "jiacheng": 24, "jiami": 2, "jian": [7, 15, 17, 26, 37, 41, 49, 50], "jianbin": 24, "jiang": [7, 15, 26, 37], "jiangshan": 37, "jianni": 23, "jianzhong": 15, "jiaqiang": 41, "jiarui": 24, "jiaxin": 26, "jiayi": 16, "jie": [5, 7, 27], "jihan": 23, "jill": 15, "jim": [50, 51], "jimin": [50, 51], "jimmi": 23, "jin": [25, 26, 37, 49], "jing": [25, 51], "jingyi": 34, "jingyuan": [14, 49], "jinja2": [1, 7, 15, 21, 25], "jinmiao": 7, "jinyuan": 15, "jiongsong": 39, "jitter": 19, "jk": 38, "jkq": 49, "jl": 21, "jmg": 49, "jo": 16, "joachim": [5, 7, 17, 23, 24, 26, 50], "joakim": [5, 6, 36, 41, 50], "joann": 51, "joaquin": [7, 11, 27, 28, 34, 48], "job": [15, 16], "joblib": [1, 7, 15, 21, 25], "joe": [23, 24], "joel": [1, 48], "joelostblom": 1, "joep": 50, "joglekar": 24, "johan": 15, "johann": [13, 14, 16, 24], "john": [5, 7, 13, 14, 15, 16, 23, 24, 28, 47, 49, 50, 51], "johnson": [7, 34], "joi": 2, "join": [3, 5, 7, 14, 15, 18, 19, 24, 26, 27, 28, 30, 49], "joint": [0, 3, 5, 7, 13, 19, 27, 28, 37, 38, 48], "joint_graph": 37, "jointli": [0, 2, 3, 5, 11, 19, 27, 34, 36, 37, 44, 48], "jointplot": 11, "jolli": 49, "jona": [7, 17, 25, 26], "jonathan": [5, 7, 11, 16, 24, 27, 28, 34, 48, 49, 50, 51], "jone": [5, 15, 24, 49, 50], "jong": [7, 15], "joon": [7, 11, 27, 28, 34, 48], "joonhyuk": 49, "joost": [23, 24, 26], "jordan": [5, 7, 14, 16, 25, 28, 36, 38, 44, 49], "jordi": [6, 50], "jorg": 23, "jorja": 4, "joseph": [2, 5, 7, 9, 15, 16, 23, 36, 49, 50], "josephin": 2, "joshua": [7, 23, 24, 34, 49, 51], "josi": [7, 49], "jost": 49, "jos\u00e9": 36, "jou": 24, "joughin": 15, "journal": [1, 2, 5, 6, 13, 14, 15, 23, 24, 39, 49, 50, 51], "jovan": [15, 36], "joyc": [2, 5], "jo\u00e3o": [17, 25], "jpeg_0": [8, 25], "jph3": 41, "jr": [1, 49], "json": [5, 21, 23], "json5": [1, 21], "jsonlit": [7, 21], "jsonlite_1": [8, 25, 27, 28], "jsonpoint": 21, "jsonschema": [1, 21], "jsonschema_specif": 21, "jt": 3, "ju": 49, "juan": [1, 13, 23], "juarez": 25, "jul": [17, 23, 24, 25], "jule": [7, 38], "juli": [5, 13, 23, 24, 50, 51], "julia": [7, 24, 50], "juliana": [5, 14, 19, 27, 28], "julien": [9, 28], "julio": [15, 25, 26, 36], "jump": [34, 36], "jun": [7, 12, 13, 14, 24, 25, 36, 37, 38, 47, 48, 49], "junankar": [2, 24], "junb": 7, "junchen": 25, "junction": [1, 2, 18, 23, 25], "junction_aa": 1, "junction_aa_vdj": 1, "junction_aa_vj": 1, "junction_length": 1, "junction_vdj": 1, "junction_vj": 1, "june": [5, 7, 23, 26, 36, 38, 41, 50, 51], "junedh": 36, "jung": [26, 51], "junguo": 39, "junha": 26, "junhong": 49, "junhou": 37, "junhyong": 9, "junji": [23, 24], "junker": 49, "junttila": 14, "junyu": [16, 23], "jupyt": [5, 6, 15, 19, 21, 42, 49, 50, 51], "jupyter_cli": [1, 7, 15, 21, 25], "jupyter_cor": [1, 7, 15, 21, 25], "jupyter_ev": 21, "jupyter_serv": [1, 5, 7, 8, 11, 21, 26], "jupyterlab": [1, 5, 6, 7, 8, 11, 13, 16, 21, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 51], "jupyterlab_serv": [1, 21], "jurek": 36, "jussi": 24, "just": [1, 2, 7, 11, 13, 14, 15, 19, 21, 23, 25, 28, 34, 36, 41, 49, 50], "justifi": [42, 50], "justin": [7, 15, 25, 50, 51], "k": [2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 34, 36, 38, 40, 43, 47, 48, 49, 50, 51], "kaduk": 1, "kadur": [5, 7, 50], "kaeser": 15, "kaesler": 36, "kageyama": 3, "kai": [4, 9, 17, 25, 26], "kaibin": 5, "kaifu": 25, "kaihara": 24, "kailong": 37, "kaiser": [17, 26], "kaiwen": [3, 7], "kaixian": 49, "kaiyang": 23, "kalend": 26, "kalhor": 49, "kall": [17, 26], "kallisto": 23, "kalmykowa": 49, "kamath": 5, "kamil": [7, 44], "kamila": 1, "kamimoto": 49, "kaminow": 23, "kaminski": [5, 7, 25, 50], "kamitaki": [23, 24], "kan": 37, "kana": 21, "kanan": 24, "kaneshiro": 9, "kang": [5, 14, 15, 25, 26], "kang_2018": [14, 16], "kang_counts_25k": [15, 25], "kang_pbmc_con": 15, "kansa": 49, "kaori": 24, "kapello": [5, 7, 17, 26, 50], "kaper": 15, "kaplan": 4, "kappa": 23, "kappa_": 36, "kappert": [17, 26], "kar": 2, "karel": 24, "karen": 16, "karikomi": 25, "karin": [17, 36, 49], "karla": 24, "karlsson": [1, 24], "karlynn": 2, "karolin": 3, "karsten": [1, 2], "kartha": 8, "karthik": [7, 13, 22, 23, 24], "kasahara": 23, "kashani": [5, 7, 50], "kasidet": 7, "kasper": [14, 19, 22, 23, 24, 51], "kassner": 36, "kastriti": [50, 51], "kat": [19, 41, 48], "kate": 3, "kath": [14, 16], "katharina": [14, 51], "katherin": [3, 4, 7, 24, 25], "kathleen": [14, 49, 50], "kathryn": [3, 5, 16], "kati": 4, "katja": [13, 40, 50, 51], "katrin": [17, 26], "katz": [13, 22, 38], "kauffman": 2, "kavita": 3, "kaya": [14, 16], "kayle": [1, 2, 5, 7, 50], "kayli": [7, 11, 27, 28, 34, 48], "kb": 24, "kb19": 31, "kb_python": 23, "kbet": [7, 28], "kbp": 8, "kcen": 7, "kcnn3": 12, "kcnq5": [5, 12], "kde": [26, 33, 34], "kde_kw": [1, 3], "kde_norm": [1, 3], "kdeplot": 11, "kdr": 38, "ke": [4, 7, 36, 38, 41, 49], "kechen": 25, "kedaigl": 24, "kedar": 24, "kedlian": 36, "kedmi": 36, "kedzierska": [3, 4], "keep": [1, 2, 5, 7, 11, 14, 15, 16, 24, 25, 26, 27, 28, 30, 31, 36, 37], "keep_batch": 7, "keep_g": 15, "kegg": 15, "keggrest_1": 8, "kei": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51], "keiichiro": 49, "keim": 51, "keir": 50, "keith": [17, 23, 24], "keito": 49, "keizer": 14, "kelder": 24, "kellei": 23, "kelli": [24, 49, 50], "kelvin": [1, 2, 48, 50], "kemal": 5, "ken": 23, "kendel": 11, "kenichi": 5, "kenji": 49, "kenneth": 49, "kenni": 25, "kent": 5, "kepler": 1, "kept": [1, 2, 3, 25], "keren": 36, "kernel": [8, 24], "kernsmooth": [7, 21], "kernsmooth_2": [8, 25, 27, 28], "kerstin": [5, 7, 50], "kester": 31, "kevan": 13, "kevin": [1, 7, 17, 22, 23, 24, 26, 44, 49], "key": 51, "key_ad": [1, 3, 5, 6, 13, 14, 15, 33, 34, 37], "key_of_dataset": 50, "khajavi": 5, "khan": [2, 7], "kharchenko": [15, 50, 51], "khatri": 14, "khodadoust": 17, "khodaverdian": 49, "khozoi": [19, 29], "ki270711": 11, "ki270713": 11, "ki270721": 11, "ki270726": 11, "ki270727": 11, "ki270728": 11, "ki270731": 11, "ki270734": 11, "kian": 49, "kibayashi": [48, 50], "kidnei": 5, "kiela": 7, "kielbasa": 14, "kieran": [5, 14], "kijima": 49, "kilian": 49, "killer": [2, 9, 25], "kilo": 24, "kilobas": 23, "kim": [1, 7, 9, 11, 15, 17, 23, 24, 25, 26, 27, 28, 34, 40, 48, 49], "kimberli": [24, 37], "kin": 7, "kind": [1, 2, 3, 7, 11, 21, 47, 49], "kindli": 30, "kinet": [49, 51], "king": [5, 36, 50, 51], "kingsford": 23, "kinzler": 49, "kip": 14, "kir": 2, "kirschenbaum": 50, "kirschner": [24, 50], "kirsi": 23, "kirsten": 49, "kirsti": 50, "kirston": [2, 24], "kiselev": [7, 25], "kiseliova": 50, "kit": [9, 24], "kitti": [13, 23], "kivioja": 24, "kiwisolv": [1, 7, 15, 21, 25], "kiya": 50, "kj": 50, "kkm": 49, "kkw": 49, "kl": [15, 27, 38], "klaeger": 50, "klappenbach": 48, "klauk": 49, "klein": [7, 11, 17, 19, 23, 24, 27, 28, 34, 37, 40, 41, 48, 49, 50, 51], "kleinstein": 1, "klenerman": 24, "kleshchevnikov": [7, 36], "klf1": 12, "klf4": [5, 12, 19], "klggalqak": 4, "klhl17": [3, 7], "klhl36": 8, "klimovskaia": 16, "klingel": 36, "klinger": [4, 15], "kloiber": 17, "klrb1": [12, 27], "klrc2": 12, "klrd1": [25, 27], "klrf1": 12, "klrg1": [5, 12, 45], "klrk1": [12, 27], "kluger": [13, 25], "kmean": 44, "knee": 23, "knight": 25, "knitr_1": [8, 25], "knn": [5, 6, 7, 8, 11, 13, 34, 36, 37], "knn_model": 5, "knn_transform": 5, "knock": 16, "knockdown": 26, "knockout": [14, 16, 26], "knocktf": 26, "know": [1, 5, 7, 15, 17, 21, 23, 24, 26, 31, 34, 36, 38, 50], "knowledg": [5, 7, 15, 17, 19, 21, 22, 24, 26, 27, 30, 50, 51], "known": [1, 2, 3, 4, 5, 6, 7, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 27, 30, 33, 34, 37, 38, 39, 43, 48, 49, 50, 51], "known_hash": [44, 45, 46, 47, 48], "ko": [4, 16, 26], "kobak": 31, "kobayashi": [5, 7], "koch": 24, "koen": 14, "koga": 34, "kohlwai": 8, "kok": 7, "kole": [5, 7, 50], "komech": 4, "kon": 25, "koneva": 4, "kong": [5, 49], "konno": 49, "konrad": 36, "konstantin": 17, "koopman": 24, "korbel": 14, "kori": 36, "korkut": 16, "korotkevich": 15, "korsunski": [5, 7, 44], "koryu": 7, "kostka": 23, "kothap": 25, "kotrov": 23, "kotton": 49, "kou": 15, "koulena": 49, "kovaltsuk": 4, "kowalczyk": [24, 50], "kowalski": 27, "kozlov": 14, "kp": 49, "kptracer": 49, "kptracer_adata": 49, "kr": [17, 26], "kra": 49, "kram": [3, 4], "kramann": 36, "krammer": [17, 26, 50], "krasnow": [5, 7, 50], "krau": 2, "krauthgam": 51, "kren": 50, "kretzmer": 49, "kri": [1, 2], "krishnaswami": [7, 11, 13, 16, 24, 27, 28, 34, 48], "kristensen": 14, "kristian": [17, 26], "kristina": 23, "kristj": [23, 51], "kristof": [8, 9], "kristoph": [27, 28, 48, 50], "kroll": 24, "kropski": [5, 7, 50], "krostag": 49, "krzysztof": [2, 7, 50], "ks19": 1, "kst": 25, "kt": 49, "kth_distanc": 13, "ku": 49, "kuan": 25, "kuang": 37, "kuchel": 11, "kucinski": 50, "kuemmerl": [19, 37, 40, 41], "kuhn": [2, 17], "kulkarni": 9, "kullback": 38, "kumar": [4, 7, 11, 15, 17, 27, 28, 34, 48, 49], "kun": [5, 15, 23, 36, 38], "kunal": 24, "kunkel": [17, 26], "kuo": [5, 7, 14, 49], "kupffer": 5, "kupp": 36, "kuppasani": [7, 11, 27, 28, 34, 48], "kuppe_snrna_human_heart_2022_control": 36, "kuppe_visium_human_heart_2022_control": 36, "kursaw": 11, "kurth": [17, 26], "kushnir": 25, "kw": 21, "kwak": 49, "kwarg": [7, 11, 13, 27, 28, 36], "kwon": [24, 49], "kxj037": 7, "kxx053": 14, "kyle": [5, 7, 37, 41, 50], "kyung": [23, 24, 49, 51], "kyungsoo": 26, "kyungta": [7, 50], "k\u00fchl": 40, "l": [2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 30, 33, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "l1": 16, "l2": 16, "l6": 49, "l9": 49, "l_": 36, "la": [14, 16, 23, 24, 50, 51], "laak": 36, "lab": [2, 7, 8, 24, 26, 50], "labalett": 24, "label": [1, 2, 3, 5, 6, 8, 11, 14, 15, 16, 17, 18, 23, 24, 25, 26, 27, 28, 36, 37, 38, 42, 49, 50], "label_col": 16, "label_color": 14, "label_fonts": [1, 4], "label_kei": [5, 7, 28], "labeling_0": [8, 27], "labels_kei": [7, 16, 36], "labor": [5, 24], "laboratori": 24, "labori": [5, 18], "lacar": 24, "lack": [13, 14, 21, 22, 23, 24, 25, 29, 43, 49, 51], "laddach": 7, "lafyati": [5, 7, 50], "lafzi": 24, "lai": [5, 37], "lake": 15, "lakshminarasimha": [5, 7, 50], "laleh": [7, 50, 51], "lam": [23, 24, 37], "lamar": [5, 14, 19, 27, 28], "lambda": [3, 4, 11, 15, 19, 23, 25, 49, 51], "lambda_1": 13, "lambiott": 6, "lamin": [9, 50], "lamindb": [49, 50, 51], "lan": [15, 23, 24], "lanata": [14, 15, 16, 25], "lanc": [5, 7, 9, 10, 11, 27, 28, 30, 34, 48, 50], "lander": 15, "landmark": 49, "landscap": [1, 2, 3, 16, 17, 23, 24, 25, 30, 34, 39, 48, 49, 50, 51], "landthal": [17, 26], "lane": [18, 23], "lang": [3, 50, 51], "langefeld": 14, "langevin": [7, 38], "languag": [1, 7, 19], "lap3": 25, "lapack": [8, 15, 25, 27, 28], "lappli": 15, "lar": [50, 51], "laraib": [23, 51], "larbi": 17, "lareau": [8, 9, 11, 48, 50], "larg": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 30, 36, 41, 45, 46, 48, 49, 50], "larger": [2, 3, 5, 7, 11, 13, 14, 15, 16, 21, 23, 33, 34, 36, 49, 50], "largest": [3, 4, 31], "larsen": 24, "larsson": 7, "laser": 2, "laserson": 1, "lasken": 24, "lassauzai": 51, "last": [1, 2, 4, 8, 11, 13, 16, 23, 27, 28, 32, 36, 38], "lastli": [11, 34], "late": [3, 5], "latent": [3, 4, 5, 7, 8, 13, 14, 16, 18, 19, 23, 27, 28, 33, 36, 51], "latent_distribut": 7, "latent_ref": 27, "later": [2, 4, 5, 7, 8, 11, 14, 15, 16, 18, 19, 21, 23, 24, 25, 27, 28, 31, 34, 37, 38, 48, 49, 50, 51], "later_1": [8, 25, 27, 28], "latest": [1, 2, 19, 22, 27, 30], "lathia": 24, "latin": 24, "latter": [4, 11, 23, 25, 34, 38], "lattic": [7, 21], "lattice_0": [8, 15, 25, 27, 28], "latticeextra_0": 25, "lau": [23, 24], "lauffenburg": 15, "lauken": 2, "lauma": 36, "launch": 34, "laur": [5, 7, 17, 26, 50], "laura": [7, 9, 10, 11, 14, 25, 27, 28, 34, 37, 48, 50], "lauren": [5, 14, 15, 16, 23, 25, 48, 51], "laurent": [19, 22], "laurenti": 50, "lauri": 5, "lava_1": 25, "lavin": 36, "law": [14, 15], "lawlor": 11, "lawrenc": [19, 22, 24, 50], "layer": [3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 25, 27, 28, 31, 32, 33, 34, 36, 37, 41, 43, 44, 45, 46, 47, 50, 51], "layout": [1, 15, 23], "layout_method": 1, "lazyev": [7, 21], "lazyeval_0": [8, 25, 27, 28], "lbc": [27, 28], "lbuttnerc": 28, "lc_address": [8, 25, 27, 28], "lc_collat": [8, 25, 27, 28], "lc_ctype": [8, 25, 27, 28], "lc_identif": [8, 25, 27, 28], "lc_measur": [8, 25, 27, 28], "lc_messag": [8, 25, 27, 28], "lc_monetari": [8, 25, 27, 28], "lc_name": [8, 25, 27, 28], "lc_numer": [8, 25, 27, 28], "lc_paper": [8, 25, 27, 28], "lc_telephon": [8, 25, 27, 28], "lc_time": [8, 25, 27, 28], "lck": 43, "lcm": 2, "lcount_cutoff_upp": 11, "lda": 16, "lda_1": 8, "lder": 14, "le": [23, 25, 50], "lead": [2, 4, 6, 8, 9, 11, 13, 15, 16, 17, 18, 23, 24, 25, 26, 28, 30, 33, 34, 36, 48, 49], "leaf": [13, 49], "leak": 34, "leander": [5, 7, 50, 51], "leandro": 51, "learn": [3, 4, 5, 6, 7, 13, 15, 16, 17, 19, 21, 22, 23, 25, 26, 27, 28, 30, 36, 38, 49, 50, 51], "learner": 30, "learnt": [19, 36], "least": [1, 5, 7, 11, 13, 16, 23, 25, 32, 34, 46, 50, 51], "leav": [13, 34, 46, 49], "leaves_in_subtre": 49, "lebofski": 8, "lebrigand": 24, "lectin": 2, "led": 23, "lee": [2, 5, 7, 14, 15, 17, 19, 24, 25, 26, 27, 28, 37, 41, 49, 50], "leeper": 49, "lef1": [5, 12, 26], "lefebvr": 6, "left": [1, 3, 7, 8, 11, 13, 16, 23, 28, 33, 41, 42, 46, 49], "legaci": 21, "legacy_api_wrap": [1, 25], "legend": [1, 5, 13, 16, 28, 49], "legend_fontoutlin": 1, "legend_fonts": [1, 5, 36], "legend_loc": [1, 5, 6, 13, 19, 36], "legibl": 5, "lei": [31, 37], "leibi": 25, "leibler": 38, "leiden": [2, 3, 5, 6, 7, 10, 19, 21, 33, 34, 36, 37, 38, 43, 50], "leiden_0": [25, 27, 28], "leiden_1": 5, "leiden_2": 5, "leiden_color": [21, 37, 38, 43], "leiden_res0_25": 6, "leiden_res0_5": 6, "leiden_res1": 6, "leiden_wnn": 21, "leidenalg": [1, 5, 6, 7, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "leif": [7, 17, 26, 48, 50], "leighton": 23, "leimk": 25, "lein": 24, "lelieveldt": 14, "lem": 2, "len": [1, 2, 3, 4, 5, 7, 14, 15, 26, 28, 38, 44, 49], "lena": [13, 16, 23], "lenail": 16, "lenei": 7, "length": [1, 2, 3, 4, 8, 11, 15, 18, 19, 21, 23, 25, 27, 28, 37, 45, 47, 49], "lenient": 34, "lenka": [14, 15, 16, 25], "lennart": 31, "lenno": 50, "lentivir": 49, "leo": 49, "leon": [4, 5, 36, 38, 49], "leonard": 16, "leonardo": 13, "leonhardt": 24, "leoni": [5, 7, 50], "leonid": [24, 49, 50], "ler": [17, 26], "leroi": [5, 7, 24], "leshchin": 49, "less": [1, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 21, 23, 26, 29, 31, 33, 34, 38, 47, 48, 49, 50], "lesser": 4, "lesson": 7, "let": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 19, 21, 25, 27, 36, 37, 38, 40, 41, 42, 43, 47, 48, 49], "letter": [1, 21], "levchenko": 25, "level": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 16, 18, 21, 23, 24, 25, 26, 28, 30, 32, 36, 43, 46, 47, 48, 49, 50], "levels_orig": 13, "levenshtein": [1, 18], "leverag": [5, 6, 11, 16, 18, 23, 25, 33, 36, 37, 38, 41, 49], "levi": [19, 22, 24], "levin": [14, 16, 23, 24, 50], "levinson": 36, "lewi": 25, "lez": [8, 15, 26], "lf": [21, 26, 28], "lfc": 14, "lfc_col": 14, "lfcs_thr": 25, "lg": 49, "lgals9": 25, "lgr_0": 8, "li": [3, 5, 7, 9, 13, 14, 15, 17, 22, 23, 24, 25, 26, 34, 36, 37, 38, 41, 48, 49, 50], "liam": [7, 50], "liana_r": 25, "liang": [4, 37, 49], "liangchen": 39, "liao": [15, 36, 37], "lib": [1, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 17, 19, 21, 25, 27, 28, 34, 36, 37, 41, 50], "lib_siz": [14, 15, 25], "liberzon": 15, "libgio": 13, "libo": 49, "libopenblasp": [8, 15, 25, 27, 28], "libpath": [10, 11], "librari": [1, 3, 7, 8, 9, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 40, 41, 48, 49], "library_kei": 36, "library_typ": 23, "lickert": [7, 11, 27, 28, 34, 48, 51], "lidschreib": [50, 51], "lie": 24, "liek": 5, "liesbeth": [8, 9], "life": [18, 19, 30, 51], "lifecycl": [7, 21], "lifecycle_1": [8, 25, 27, 28], "lifetim": 1, "ligand": 16, "ligand_act": 25, "ligand_complex": 25, "ligand_mean": 25, "ligand_oi": 25, "ligand_prop": 25, "ligand_target_df": 25, "ligand_target_matrix": 25, "ligand_target_matrix_nsga2r_fin": 25, "ligand_target_potenti": 25, "ligat": [18, 24], "light": [2, 4, 49], "lightn": [16, 36], "lightning_fabr": 36, "lightningdeprecationwarn": [7, 27, 28], "lightweight": 23, "lihua": [4, 25], "lijuan": 7, "like": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "likelihood": [8, 13, 14, 23, 28, 49, 51], "likewis": [1, 23], "lili": 25, "lilrb1": 27, "lilrb2": [8, 25], "lim": [5, 7, 50], "limit": [2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 21, 22, 23, 24, 34, 36, 37, 38, 39, 45, 49, 50, 51], "limma": [14, 25], "limma_3": [15, 25], "lin": [7, 13, 25, 36, 38, 43, 49], "lina": [24, 50], "linag": [12, 25], "linc01128": 7, "linc01409": 7, "linda": [17, 24, 26, 36], "lindeman": 2, "lindenbaum": 13, "lindsai": 22, "line": [1, 2, 3, 4, 7, 8, 11, 15, 16, 18, 23, 41, 51], "lineag": [1, 2, 3, 4, 5, 13, 15, 18, 25, 50, 51], "lineage_group": 49, "lineage_util": 49, "lineagegrp": 49, "lineageot": 49, "linear": [1, 2, 3, 4, 5, 11, 13, 14, 15, 17, 24, 28, 31, 33, 34, 36, 50, 51], "linestyl": 11, "linewidth": 13, "lingjuan": 49, "linh": [5, 7, 50], "linhui": 25, "link": [1, 3, 4, 5, 6, 7, 8, 9, 18, 21, 25, 26, 39, 41, 44, 49], "linkag": [1, 4], "linker": 24, "linkinghub": 25, "linnarsson": [23, 24, 50, 51], "linslei": 14, "linton": 49, "linu": 37, "linux": [1, 8, 25, 27, 28], "linzhao": [36, 38], "lior": [7, 23, 51], "lipinski": 38, "liposaccharid": 2, "liquid": 2, "liqun": 37, "lira": [2, 7, 50], "lisa": [3, 4, 5, 7, 50], "lisbi": 37, "lisgo": 50, "list": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "listdata": 17, "listenv": [7, 21], "listenv_0": [25, 27, 28], "litchfield": 49, "liter": 18, "literatur": [5, 13, 23, 49], "litinetskaya": [13, 14, 15, 21, 27, 28], "littl": [11, 16, 24, 28, 49], "litvi": 7, "litzenburg": 50, "liu": [3, 4, 5, 7, 15, 17, 23, 24, 25, 26, 36, 37, 38, 39, 48, 49, 50, 51], "live": [1, 18, 24, 30, 50], "liver": 38, "livnat": 16, "liwen": 15, "lixia": 48, "ljz20": 49, "lk": 1, "lken": 50, "ll": [5, 15, 17, 23, 40, 43, 49, 51], "ller": [7, 11, 13, 15, 17, 23, 26, 27, 28, 34, 48], "llner": 50, "lloyd": 50, "llquist": 50, "llr": 41, "llvmlite": [1, 7, 15, 21, 25], "lm": 15, "lme4": 14, "lmtest": [7, 21], "lmtest_0": [25, 27, 28], "lmweber": 22, "ln": 50, "lncrna": 18, "lo": [13, 23, 43], "load": [1, 3, 4, 6, 7, 9, 11, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41], "load_ext": [7, 11, 14, 15, 17, 21, 25, 27, 28, 32, 33, 34], "load_fri": 23, "load_model": 3, "load_query_data": [5, 27], "loaded_data": 16, "loader": [16, 21], "loadfri": 23, "loadh5seurat": 21, "lobo": 14, "loc": [1, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 38, 45, 46, 48, 49], "local": [1, 5, 7, 8, 9, 13, 15, 23, 25, 26, 27, 28, 31, 36, 41], "local_rank": [5, 27, 28, 36], "locat": [1, 2, 5, 7, 11, 18, 19, 23, 24, 26, 36, 37, 38, 39, 41, 49], "locfit_1": 15, "loci": [1, 18, 23], "locu": [1, 2, 18, 23], "locus_statu": 1, "locus_vdj": 1, "locus_vj": 1, "loeb": [23, 24], "loess": 14, "log": [1, 3, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 25, 27, 28, 32, 33, 34, 36, 37, 41, 49, 50], "log10": [11, 13, 15, 26, 36], "log10p": 8, "log1p": [3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 32, 33, 34, 37, 50, 51], "log1p_mean_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_n_genes_by_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_norm": [31, 33], "log1p_total_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_total_counts_hb": 34, "log1p_total_counts_mt": [34, 37], "log1p_total_counts_ribo": 34, "log1ppf": 6, "log2": [13, 14], "log2fc": 25, "log_": 15, "log_2": 15, "log_every_n_step": 36, "log_fold_chang": 14, "log_lib_s": 14, "log_norm_x": 15, "log_scal": 48, "log_total_fragment_count": 11, "log_transform": 19, "logarithm": [14, 31, 34, 51], "logcount": [7, 13, 21], "logcpm": [13, 14, 15], "logcpm_fl": 15, "logcpm_fle_pca": 15, "logfc": [13, 14, 15, 25], "logfold": 14, "logfoldchang": [14, 43], "logger": [7, 14, 27, 28, 32, 33, 34], "logic": [1, 25], "logist": 13, "logistic_regression_classifi": 16, "logo": 1, "logo_motif": 1, "logq": 14, "logratio": 13, "loh": [7, 44], "lolita": 7, "lollipop": 16, "lomakin": 36, "londo": 50, "london": [2, 42], "long": [2, 3, 4, 8, 9, 11, 13, 17, 19, 21, 23, 24, 25, 37, 49, 51], "longer": [3, 6, 7, 8, 15, 19, 24, 51], "longfei": [36, 38], "longlong": 4, "longqi": 37, "lonrf1": 8, "looger": 24, "look": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "lookup": 25, "loom": 26, "loom_path": 26, "loom_path_output": 26, "loomi": [16, 47, 48, 50], "loompi": 26, "loop": [5, 14, 27, 30, 36], "loos": 49, "lope": 25, "lopez": [5, 7, 16, 23, 25, 27, 28, 36, 38, 44, 49, 50], "loren": 24, "lorenzi": 25, "lorenzo": [17, 23, 26, 38], "lorrain": 5, "lose": [31, 34, 39], "loss": [1, 7, 9, 13, 23, 24, 27, 28, 36], "loss_coef": 27, "loss_weights_kl": 3, "loss_weights_tcr": 3, "lost": [2, 18, 44], "lot": [5, 21], "lotfollahi": [3, 5, 7, 16, 19, 37, 40, 41, 50, 51], "loui": [19, 37, 40, 41], "louie": 2, "louis": [1, 7, 11, 27, 28, 34, 48, 50], "louisa": 36, "loup": [6, 23], "louvain": [1, 5, 6, 7, 21, 37, 50], "louzoun": 4, "love": [14, 19, 22, 23], "loveless": 49, "low": [1, 4, 5, 7, 9, 11, 13, 14, 16, 17, 18, 23, 24, 25, 26, 28, 29, 31, 33, 37, 38, 39, 40, 43, 45, 47, 48, 50, 51], "low_memori": [3, 49], "low_qc": 49, "lower": [1, 3, 6, 7, 13, 14, 16, 23, 24, 26, 31, 34, 36, 38, 46, 48, 49, 50, 51], "lowest": [3, 7, 24, 25, 26, 31], "lowli": [5, 16, 25], "lowqval_d": 14, "loyal": 51, "lp": 26, "lppantnsf": 4, "lppvytnsf": 4, "lpsyaafat": 4, "lqab023": 2, "lqaenvtgl": 4, "lr": [3, 36], "lr_gmean": 25, "lr_logfc": 25, "lr_mean": 25, "lr_network": 25, "lr_network_human_21122021": 25, "lr_prob": 25, "lrc": 49, "lrs_to_keep": 25, "lrschedul": 27, "lrscore": 25, "lsi": [10, 19], "lsi_1": 10, "lsw22": 25, "lt": [8, 10, 25], "ltdemiaqi": 4, "ltj": 49, "lu": [4, 7, 16, 23, 37, 38, 43, 51], "lu_merfish_mouse_fetal_liver_2021": 38, "lu_scrna_mouse_fetal_liver_2021": 38, "lubeck": 29, "lubridate_1": 25, "luc": [11, 32, 33, 34], "luca": [11, 14, 17, 24, 40], "lucero": 9, "lucian": 17, "luciani": [2, 24], "luckili": 51, "ludmil": 49, "ludvig": [2, 7, 36], "ludwig": [7, 21, 22, 48, 50], "luecken": [5, 7, 11, 14, 22, 27, 28, 34, 48, 50], "lui": [16, 24, 49], "luisa": 13, "luka": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "lukassen": [7, 40], "lukasz": 14, "luke": [5, 7, 9, 21, 23, 30, 34, 50], "luli": 36, "luminesc": 24, "lun": [7, 11, 13, 15, 22, 23], "luna": 16, "lundberg": 39, "lundeberg": [5, 36, 41], "lung": [5, 7, 13, 50], "lungmap": 7, "luo": [4, 7, 15, 24, 48, 50], "luoma": 16, "lupu": [14, 16, 25], "lusser": 50, "lustr": [10, 27, 28], "luyi": 23, "luz": [15, 23, 24, 25, 26], "lvarez": 24, "lx2xownlrhz3us8496tyu9c4dgade814": 23, "lxml": 1, "ly": 24, "lymph": [5, 7, 12], "lymphocyt": [1, 2, 24], "lymphoid": [5, 15, 36], "lyn": [5, 12], "lynch": 7, "lyndsai": 23, "lysi": [24, 34], "lyz": [5, 12], "l\u00fccken": [7, 22], "m": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 34, 36, 37, 38, 40, 41, 47, 48, 49, 50, 51], "m0": 26, "m1": 23, "m2": 23, "m_": 38, "m_j": 38, "ma": [4, 8, 13, 14, 15, 17, 37, 38, 41], "maarten": 5, "maatz": 7, "maayan": 17, "mac": [2, 5], "macadlo": 5, "macaqu": 1, "macaulai": [24, 30], "macdonald": [19, 22], "machin": [3, 4, 5, 6, 7, 16, 19, 23, 24, 26, 30], "machineri": [24, 26], "machleidt": [17, 26], "macklaim": 13, "maclean": 25, "macnair": 11, "maco": [7, 15, 21], "macosko": [23, 24, 36, 38], "macqueen": 50, "macrophag": 5, "mad": 34, "madad": 27, "maddi": [5, 14, 19, 27, 28], "made": [0, 5, 15, 16, 21, 23, 24, 34, 47, 49], "madelin": 27, "madhura": 49, "madisen": 24, "madissoon": [5, 7, 50], "madrid": 42, "maduro": [7, 49], "mae": 21, "magalh\u00e3": 17, "magda": [25, 50], "magic": [3, 11, 21], "magic_cpm": 21, "magic_imputed_data": 50, "magma": 36, "magnet": 2, "magnitud": [14, 25, 49], "magnitude_rank": 25, "magnon": 24, "magnusson": 14, "magrittr": [7, 21], "magrittr_2": [8, 25, 27, 28], "magrud": 17, "mahajan": 4, "mahbubani": 5, "mahdi": [19, 29], "mahfouz": [5, 14, 24, 38], "mahmoud": [15, 26], "mai": [2, 3, 4, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 41, 43, 45, 48, 50, 51], "main": [3, 7, 8, 9, 13, 15, 17, 19, 21, 23, 25, 26, 34, 36, 37, 41, 48, 49], "mainexpnam": [7, 21], "mainli": [1, 2, 3, 4, 15, 17, 24, 36, 51], "maintain": [0, 6, 17, 18, 21, 24, 44], "maintenance_cocain": 16, "mair": [47, 48], "mait": [5, 12], "major": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 28, 43, 49], "major_label": 36, "major_labl": 36, "majority_vot": 5, "majorli": 26, "makarov": 16, "make": [1, 4, 5, 7, 10, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 27, 28, 29, 31, 33, 34, 36, 38, 41, 43, 44, 47, 48, 49], "make_nhood": 13, "makecontrast": [14, 15], "makesummarizedexperimentfromdatafram": 8, "maksim": 25, "malat1": [14, 19], "male": 2, "mali": 49, "malik": [23, 51], "maliskova": [14, 15, 16, 25], "malka": 15, "malt": [5, 7, 11, 14, 22, 23, 27, 28, 34, 48, 50], "malu": 16, "mamanova": [2, 5, 7, 50], "mambaforg": 11, "mammalian": [23, 49], "mamoru": 49, "manag": 21, "manakongtreecheep": 7, "manasa": 49, "mancilla": 16, "mandeep": [2, 24], "mandoiu": 14, "mangul": 17, "mani": [0, 1, 2, 4, 5, 6, 8, 9, 11, 13, 14, 16, 17, 19, 21, 23, 24, 25, 26, 29, 32, 33, 34, 36, 39, 47, 48, 49, 50, 51], "manifest": 30, "manifold": [25, 31, 50, 51], "maniou": 23, "manipul": [8, 19, 49], "mann": 29, "manner": [2, 4, 7, 15, 24, 25], "manno": [14, 16, 23, 24, 50, 51], "manu": [5, 7, 15, 50, 51], "manual": [7, 11, 13, 14, 15, 21, 23, 24, 29, 34], "manual_celltype_annot": 5, "manufactur": 24, "manuscript": 25, "manz": 1, "mao": 23, "map": [2, 3, 4, 6, 7, 8, 9, 11, 15, 16, 17, 18, 24, 25, 26, 28, 42, 43, 49, 50, 51], "map_cells_to_spac": 38, "mapk": 15, "mapping_dict": 3, "mapqueri": 27, "maptool": 21, "mar": [2, 5, 9, 16, 24, 25, 27, 28, 37, 50], "mara": 50, "marc": [7, 19, 22, 24, 36, 37, 50], "marcel": [5, 14, 23, 38], "march": [6, 7, 9, 11, 13, 34, 39, 41, 50, 51], "marcin": [49, 50], "marco": [5, 7, 16, 23, 49], "marco2022optim": 23, "marcu": 23, "maren": [5, 7, 50], "mare\u010dkov\u00e1": 25, "margaret": [23, 49], "margarita": 9, "margin": [27, 42], "mari": [1, 5, 7, 25, 48, 50, 51], "maria": [1, 14, 17, 23, 24, 26, 49, 50, 51], "mariam": 49, "mariana": 50, "mariann": 43, "mariano": [7, 28], "mariek": 51, "marijn": [5, 7, 50], "marin": [15, 26], "marini": 22, "marion": 7, "marioni": [7, 13, 14, 15, 23, 28, 50, 51], "marionilab": [13, 33], "marisa": 50, "marissa": 4, "mariu": [50, 51], "marjaneh": [19, 29], "marjanov": 24, "mark": [1, 4, 5, 6, 7, 11, 13, 14, 16, 17, 23, 24, 26, 32, 33, 34, 47, 49, 50, 51], "markedli": 23, "marker": [2, 3, 7, 8, 11, 13, 14, 15, 17, 18, 24, 28, 38, 41, 43, 44, 45, 48, 49], "marker_gen": [5, 8, 12], "marker_genes_in_data": 5, "marker_prot": 12, "markers_found": 5, "markert": 1, "market": 24, "marko": [5, 7, 50], "markov": [5, 7, 37, 49, 50], "marku": [1, 4, 17, 26, 29], "markupsaf": [1, 7, 15, 21, 25], "marleen": 14, "marlen": [2, 19], "marlon": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "marot": 51, "marouf": 17, "marquett": 5, "marriag": 49, "marrow": [2, 5, 7, 28, 34, 48], "marschal": 14, "marshal": 49, "mart": 49, "marta": [5, 24, 51], "marten": [9, 10, 11, 28], "martersteck": [23, 24], "martha": 24, "martijn": [5, 7, 24, 50], "martin": [1, 5, 7, 9, 14, 17, 19, 22, 24, 25, 26, 32, 47, 49], "martina": [13, 15], "martincorena": 49, "martinez": [3, 49], "martino": 25, "martowicz": 13, "martuza": 49, "marvin": [29, 50], "masahiro": [1, 2, 5, 7, 23, 50], "masanao": [14, 34], "masatoshi": 49, "mascibroda": 16, "mask": [1, 7, 11, 19, 24, 26, 27, 32], "mask_dropout": 26, "mason": 49, "masoud": 24, "masqueli": [23, 24], "mass": [6, 7, 13, 21, 29], "mass_7": [8, 25, 27, 28], "massiv": [0, 16, 23, 24, 29, 39, 48, 50, 51], "mast": [5, 14, 36], "mast_cd14_monocyt": 14, "master": [8, 23, 25, 26, 49], "masuyama": 49, "mat": [8, 25], "match": [2, 5, 7, 8, 10, 11, 15, 16, 17, 19, 21, 23, 24, 26, 27, 36, 38], "match_sequ": 4, "matching_row": 4, "matching_sequ": 4, "matej": 51, "materi": [18, 23, 24, 30], "mateu": 13, "mateusz": 1, "math": 13, "mathbb": 38, "mathbf": 38, "mathemat": [15, 50], "mather": 50, "mathew": 15, "mathia": [24, 37], "mathild": 49, "mathop": 41, "mathsemicolon": 50, "matia": 23, "matin": 5, "matplotlib": [1, 4, 5, 7, 11, 13, 14, 15, 19, 21, 25, 26, 28, 32, 33, 36, 38, 49], "matplotlib_inlin": [1, 7, 15, 25], "matric": [3, 4, 8, 14, 15, 17, 18, 21, 23, 28, 34, 38, 45, 49], "matrix": [1, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 40, 49, 51], "matrix_1": [8, 15, 25, 27, 28], "matrixgener": [7, 21], "matrixgenerics_1": [8, 15, 27, 28], "matrixplot": 26, "matrixstat": [7, 21], "matrixstats_0": [8, 15, 25, 27, 28], "matsen": 49, "matson": [14, 16], "matt": [5, 23], "matteo": 17, "matter": [7, 14, 49], "matthew": [2, 4, 7, 14, 15, 16, 19, 23, 24, 25, 29, 34, 37, 47, 49], "matthia": [17, 24, 26, 29], "matthieu": [14, 16, 51], "matur": [1, 2, 4, 13, 18, 50, 51], "mauck": [5, 7, 14, 16, 19, 27, 28], "maunder": 50, "mauric": 36, "mauricio": 5, "maurizio": [7, 11, 27, 28, 34, 48], "max": [2, 3, 5, 7, 8, 14, 16, 17, 23, 26, 27, 49, 50], "max_col": 1, "max_color_quantil": 36, "max_count": 48, "max_delta": 41, "max_epoch": [5, 7, 13, 16, 27, 28, 36], "max_epochs_scanvi": 7, "max_epochs_scvi": [7, 13], "max_gen": 19, "max_i": 38, "max_it": 3, "max_ll": 41, "max_ll_nul": 41, "max_mean": 19, "max_miss": 1, "max_mu_hat": 41, "max_out_group_fract": 5, "max_ribbon": 1, "max_s2_t_hat": 41, "max_seg": 1, "max_siz": 1, "maxcutoff": 8, "maxim": [3, 7, 15, 16, 17, 23, 38, 49, 51], "maximilian": [3, 7, 17], "maximum": [1, 5, 8, 9, 11, 15, 16, 36, 48, 49], "maximum_percent_uncut_in_cel": 49, "maxit": 11, "maxwel": [24, 37], "mayr": [3, 5, 7, 50], "mayu": [48, 50], "mazuti": [24, 50], "mazzeo": 25, "mb": [2, 4, 24, 49], "mbano": 7, "mbiguou": 23, "mbp": 41, "mc9nr": 26, "mcadam": 7, "mcalpin": 5, "mccarrol": [23, 24], "mccarthi": [5, 14, 15, 16, 24, 25], "mcclanahan": 48, "mcconeghi": 23, "mcconnel": 24, "mccorrison": 24, "mcdavid": 14, "mcdermott": [23, 24], "mcdonald": 50, "mcelrath": [5, 14, 19, 27, 28], "mcfalin": 16, "mcfarland": [23, 24], "mcgaughei": 7, "mcgeever": [7, 11, 27, 28, 34, 48], "mcginni": [11, 23], "mcgranahan": 49, "mcgrath": 50, "mchardi": 14, "mckenna": 49, "mcmc": 49, "mcmurrough": 13, "mcmv": 4, "mcnamara": 3, "mcpa": 4, "mcpherson": 5, "mcq": 42, "md": [6, 14, 19, 48], "md5": 19, "mdata": [11, 13, 16, 19, 21, 28, 44, 45, 46, 47, 48], "mdata_multiom": 28, "mdata_r": 19, "mdata_raw": [47, 48], "mdata_sub": 19, "mdc": 17, "mean": [1, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 41, 47, 49, 50, 51], "mean_accuraci": 16, "mean_auc": 16, "mean_auc_by_cell_typ": 26, "mean_auc_by_cell_type_top_n": 26, "mean_augur_scor": 16, "mean_augur_score1": 16, "mean_augur_score2": 16, "mean_count": [11, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "mean_f1": 16, "mean_n_cel": 13, "mean_precis": 16, "mean_recal": 16, "meaning": [5, 7, 9, 11, 15, 17, 23, 25, 32], "means_per_cluster_mu_fg": 36, "means_per_cluster_mu_fg_": 36, "meanscor": 8, "meant": [25, 30], "measur": [1, 2, 3, 5, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 38, 41, 43, 47, 48, 49, 50, 51], "mebocost": 25, "mechan": [1, 2, 6, 9, 14, 16, 17, 18, 24, 30], "mechanist": 8, "mecom": [5, 12], "median": [5, 13, 33, 34, 48], "median_abs_devi": [34, 48], "mediat": [8, 16, 25], "medic": 1, "medicin": [1, 2, 3, 5, 7, 15, 49, 50], "medina": 51, "medium": [4, 6], "meena": [14, 15, 16, 25], "meet": 49, "mega": [7, 24, 50], "megakaryocyt": [5, 14, 16, 17, 25], "megason": 50, "meghan": 50, "mehlman": 7, "mehmood": 14, "mei": [5, 7, 13, 17, 22, 25, 26, 37, 50], "meier": 29, "meifang": [36, 38], "meirel": 15, "meisel": [17, 26], "meixid": 11, "mejia": 49, "mekonen": [7, 11, 27, 28, 34, 48], "melani": [17, 24, 26], "melania": 51, "meld": 13, "melgarejo": [7, 11, 27, 28, 34, 48], "melissa": [23, 24], "melm": 16, "melst": [23, 51], "melt": [2, 13], "melton": 17, "melvin": 29, "member": [1, 40], "membership": 15, "membran": [2, 18, 24, 25, 34, 43], "memoise_2": 8, "memori": [1, 2, 5, 11, 17, 19, 23, 26, 34, 50, 51], "memp": 5, "mend": 50, "menden": 17, "meng": [15, 25, 26, 38], "mengnan": 37, "mengzh": 37, "menon": [5, 24, 49], "mention": [1, 4, 6, 7, 9, 13, 14, 15, 19, 21, 23, 24, 25, 26, 31, 32, 34, 37, 48], "menzel": 36, "mer": [1, 4, 17, 26], "merav": 36, "merchant": 14, "mere": 5, "mereu": [15, 24, 36], "merfish": [37, 38, 39], "merg": [1, 3, 5, 7, 8, 11, 14, 19, 27, 28], "merge_with_ir": 3, "meritxel": 17, "mesenchym": 15, "meshal": [3, 5, 7, 50, 51], "mesirov": 15, "messag": [1, 8, 10, 11, 15, 21, 25, 27, 28, 50], "messeng": [18, 51], "met": 51, "meta": [7, 11, 21, 34, 49], "meta_data": 49, "meta_item": 49, "metabol": [15, 24, 25, 50], "metabolit": 25, "metadata": [1, 3, 7, 10, 11, 14, 17, 18, 21, 23, 27, 34, 38, 49], "metastasi": 49, "metastat": 49, "metfamili": 49, "method": [1, 2, 3, 4, 5, 6, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 47, 48, 50, 51], "methodolog": [13, 14, 15, 43], "methodologi": [1, 14, 23, 49], "methodss3_1": 8, "methyl": [9, 18], "meticul": 49, "metric": [1, 3, 5, 7, 8, 16, 18, 19, 23, 26, 27, 29, 34, 36, 38, 48], "metrics_bbknn": 7, "metrics_fast": 7, "metrics_hvg": 7, "metrics_mofa": 28, "metrics_sc": 7, "metrics_scanvi": 7, "metrics_scvi": 7, "metrics_seurat": 7, "metrics_totalvi": 28, "metrics_wnn": 28, "meyer": [5, 7, 50], "meysman": 2, "mfg": 49, "mftg22": 28, "mg19": 49, "mgat4a": 8, "mgcv": 7, "mgcv_1": 27, "mh8919227": 2, "mh8919326": 2, "mh8919329": 2, "mh9143270": 2, "mh9143270_contig_1": 2, "mh9143270_contig_2": 2, "mh9143274": 2, "mh9143275": 3, "mh9143324": 2, "mh9143373": 2, "mh9143420": 2, "mh9143423": 2, "mh9143424": 2, "mh9179824": 2, "mhc": [2, 4], "mhci": 4, "mi": [14, 16], "mia": 49, "miao": [7, 9, 23, 38], "mice": [1, 4, 13, 16], "mich": 49, "micha": 25, "michael": [1, 2, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 34, 36, 37, 38, 44, 48, 49, 50], "michaela": [7, 11, 23, 27, 28, 34, 36, 48], "michal": [1, 7, 19, 37, 38, 40, 41, 50, 51], "michel": [5, 7, 14, 15, 16, 17, 25, 49], "michiel": 36, "michielsen": 5, "micro": 24, "microarrai": [7, 14, 15, 17, 24], "microbead": 24, "microbi": [13, 17], "microbiol": 13, "microbiom": [13, 24], "microdissect": 2, "microenviron": [5, 25], "microfila": 24, "microfluid": [2, 23, 49], "microfluifd": 2, "microglia": 16, "micrographia": 24, "microparticl": 24, "microprocessor": 23, "microscop": [1, 2, 24, 49], "microtubul": 24, "microtubular": 24, "microwel": 24, "micura": 50, "mid": [5, 49], "middl": [16, 23, 38], "miescher": 24, "might": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 41, 43, 48, 49], "migrat": [24, 25], "migratori": 5, "miguel": [11, 37], "mika": [36, 50], "mike": 22, "mikhail": 4, "mikkelsen": [23, 24], "milano": 16, "mild": 2, "mile": 34, "millard": [5, 7, 44], "miller": [5, 14, 23, 24], "million": [7, 18, 19, 21, 23, 33, 48], "milo": 13, "milo_composit": 13, "milo_connect": 13, "milo_dist": 13, "milo_results_salmonella": 13, "milor": 13, "milt": 36, "mime": [7, 21], "mime_0": [8, 25, 27, 28], "mimic": [2, 27], "mimit": [5, 14, 16, 19, 27, 28, 48, 50], "min": [1, 7, 8, 13, 14, 15, 16, 17, 23, 24, 25, 33, 34, 42, 49, 51], "min_cel": [1, 4, 7, 14, 16, 19, 25, 34, 37], "min_clade_s": 49, "min_clone_s": 1, "min_count": 50, "min_depth": 49, "min_disp": 19, "min_dist": [19, 36], "min_gen": [14, 19, 25], "min_in_group_fract": 5, "min_intbc_thresh": 49, "min_mean": 19, "min_nod": 4, "min_prop": 25, "min_shared_count": 51, "min_siz": 13, "min_smpl": 25, "mind": [9, 11, 13, 19, 25, 34, 49], "mine": 9, "ming": [15, 37], "mingbo": 36, "minghao": [36, 38], "mingxiang": 14, "mingyao": [37, 41], "miniatur": [23, 24], "miniconda": [4, 7], "miniconda3": [5, 6, 8, 10, 15, 19, 21, 27, 28, 34, 36, 37, 41], "miniforge3": 50, "minim": [6, 7, 11, 13, 16, 17, 23, 24, 26, 49], "minimap2": 23, "minimum": [5, 11, 13, 15, 18, 25, 49, 50], "minimum_intbc_thresh": 49, "minimum_number_of_cel": 49, "minion": 24, "miniui": [7, 21], "miniui_0": [8, 25, 27, 28], "minkina": 49, "minmaxscal": 38, "minnoy": [8, 9], "minor": [9, 38], "minseok": 49, "minut": [3, 7, 8, 9, 13, 25, 26, 41], "minzh": [5, 7, 50], "miqc": 23, "miquel": [23, 25], "mir1302": [10, 11, 19, 36], "miragaia": 24, "mirel": 50, "mireya": [6, 50], "miriam": [17, 26], "mirjana": [25, 50], "mirna": 18, "mirror": 49, "misassign": 24, "misc": [7, 15, 19, 25], "miscal": 23, "miscellan": 21, "misclassifi": 34, "mishael": 26, "misharin": [5, 7, 50], "misinterpret": [1, 34], "miska": 50, "mislead": [13, 15, 16, 23, 25, 51], "mismatch": [23, 24], "misrachi": 7, "miss": [1, 2, 3, 4, 5, 10, 11, 13, 14, 16, 17, 18, 19, 23, 25, 27, 28, 29, 34, 38, 49], "missing_gen": 5, "missing_gene_adata": 5, "missing_hvg": 7, "missing_on_read": 10, "mistak": 49, "mistaken": 15, "mistakenli": 18, "mitch": 4, "mitchel": [17, 49], "miten": 24, "mitic": 49, "mitig": [7, 13, 14, 16, 23, 43, 44], "mito": [16, 17], "mitochondri": [11, 23, 34, 36, 37], "mitochondria": [34, 36], "mittal": 9, "mix": [2, 5, 7, 11, 13, 14, 15, 17, 19, 24, 49], "mixed_cel": 17, "mixscap": 16, "mixscape_class": 16, "mixscape_class_glob": 16, "mixscape_vignett": 16, "mixtur": [2, 3, 5, 16, 17, 24, 28, 36, 49, 51], "mizani": [1, 25], "mk": [5, 7, 12], "mkdir": [5, 23, 51], "mki67": [5, 12], "ml": 3, "ml01": [10, 17, 27, 28], "ml_collect": 7, "mlapi_0": 8, "mlrmbo": 25, "mm10": 8, "mm3": 17, "mm_best": 10, "mmd": 27, "mme": [5, 12], "mmt22": 47, "mnist": 16, "mnp": 5, "mobil": 2, "mock": 21, "mod": [10, 11, 19, 36], "modal": [2, 4, 7, 10, 11, 13, 16, 18, 19, 21, 25, 27, 28, 30, 38, 44, 45, 46, 47, 48, 50], "modality_kei": 13, "modality_length": 27, "modatac": 10, "mode": [1, 3, 16, 19, 23, 24, 26, 28, 38, 41, 51], "model": [1, 4, 5, 8, 9, 11, 13, 14, 15, 18, 19, 21, 23, 24, 27, 28, 31, 32, 33, 37, 38, 41, 44, 50], "model_contrast": 13, "model_high": 5, "model_low": 5, "model_nam": 3, "model_scanvi": 7, "model_scvi": [7, 13], "model_select": 3, "modelmatselect": 8, "modelmetrics_1": 25, "moder": [2, 14, 15], "modern": [23, 24, 40, 50], "modest": 23, "modgene_act": 10, "modif": [7, 9, 19, 23, 24, 25, 26], "modifi": [1, 2, 7, 8, 9, 11, 16, 19, 21, 23, 24, 25, 28, 34], "modrna": 10, "modul": [5, 6, 7, 8, 11, 15, 16, 19, 21, 23, 25, 26, 27, 28, 36, 49], "modular": [23, 51], "modularli": 23, "moe": 3, "moerman": [15, 26], "mofa": 21, "mofa_1": 21, "mofa_20230103": 28, "mofa_umap": 21, "mofa_umap_": 21, "mofaumap_": 21, "mofaumap_1": 21, "moffett": 25, "moffitt": 39, "moham": [1, 16, 17], "mohammad": [3, 5, 7, 16, 17, 19, 37, 40, 41, 50, 51], "mohsen": [5, 16, 23, 51], "moira": [17, 26], "mojaveazur": 21, "mol": 24, "molcel": 24, "molecul": [5, 9, 18, 23, 24, 25, 33, 34, 39, 49, 51], "molecular": [1, 2, 7, 14, 15, 16, 17, 18, 22, 23, 24, 25, 29, 30, 34, 49, 50, 51], "molin": 50, "molina": 51, "molla": 27, "mollenau": 43, "molli": [14, 49], "molotski": 51, "moment": [23, 26, 51], "mompel": 15, "monaco": 17, "monica": 36, "monika": [3, 7, 17, 24, 50], "monitor": [2, 16, 18, 27, 28], "mono": [5, 7, 11, 12, 15, 26], "mono_1": 50, "mono_2": 50, "monochromat": 23, "monocyt": [5, 14, 15, 16, 19, 25, 46], "mononuclear": [2, 7, 14, 16, 19, 28, 34, 48, 51], "mont": 49, "montesclaro": [23, 24], "montgomeri": 16, "month": 49, "monther": 14, "montoro": 7, "montoya": 17, "moodi": 5, "moor": 48, "mootha": 15, "mor": 38, "mora": 1, "morani": 41, "more": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 33, 34, 37, 38, 39, 40, 43, 44, 46, 47, 48, 49, 50, 51], "morelli": 13, "moreov": [5, 14, 23, 24, 25, 48], "moreto": 23, "morgan": [1, 2, 7, 13, 19, 22], "mori": 49, "moritz": [17, 26, 36, 49], "morpholog": [2, 18], "morphologi": 37, "morri": [7, 11, 16, 27, 28, 34, 48, 49], "morshui": 36, "morten": 4, "mosaic": [27, 49], "mosh": [13, 22], "most": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 17, 19, 21, 22, 23, 24, 25, 26, 28, 30, 32, 34, 36, 37, 38, 43, 46, 47, 48, 49, 50, 51], "mostafa": [24, 51], "mostli": [1, 4, 5, 11, 16, 24, 31, 32, 33], "motamedi": 9, "motif": [2, 3, 4, 8, 26], "motif2tf": 26, "motif_back": 3, "motif_ifng": 3, "motif_path": 26, "motifmatchr": [8, 11], "motifmatchr_1": 8, "motiv": [2, 19], "mottok": 5, "moun": 11, "mour": 23, "mourragui": 38, "mous": [4, 5, 7, 15, 16, 17, 22, 23, 24, 26, 34, 37, 40, 41, 45, 47, 51], "mousa": 5, "moutinho": 24, "mouton": 17, "move": [1, 5, 6, 7, 14, 15, 16, 21, 23, 25, 27, 28, 29, 36, 49], "mpl": 1, "mpl_toolkit": [1, 7, 15, 21, 25], "mpo": [5, 12], "mpp": 5, "mpv17": 30, "mrna": [7, 9, 16, 17, 18, 23, 24, 34, 48, 50, 51], "mrpl15": [38, 41], "mrvi1": 38, "ms2": 24, "ms4a1": [5, 12, 27], "msb": [7, 14, 22, 29, 50, 51], "mse": 27, "msg": 4, "msgpack": 7, "msi2": [5, 12], "msigdb": 15, "mst": 50, "msu": 23, "mt": [7, 11, 21, 34, 36, 37], "mt2a": 25, "mt_gene": [36, 37], "mt_outlier": 34, "mtab": 3, "mtg": 27, "mtrnr2l1": 12, "mtx": 23, "mu": [11, 16, 19, 28, 33, 36, 37, 44, 45, 46, 47, 48, 51], "mu_": 36, "much": [1, 5, 6, 7, 11, 12, 13, 14, 16, 19, 23, 24, 33, 36, 38, 44, 49], "mudata": [7, 11, 13, 16, 18, 21, 28, 30, 44, 45, 46, 47], "mudataset": 19, "mudataseurat": [10, 21], "mueller": [7, 28], "muk22": 49, "mukamel": 9, "mukherje": 15, "mukhopadhyai": 49, "mulder": 37, "mulholland": 49, "multi": [1, 2, 3, 7, 8, 11, 14, 17, 18, 19, 22, 23, 25, 27, 36, 45, 48, 49, 51], "multi_chain": [1, 2, 4], "multi_id": 16, "multi_panel": 19, "multiassayexperi": 21, "multicellular": [24, 25], "multichain": 2, "multicolor": 49, "multicor": 3, "multicoreparam": 33, "multicoretsn": [3, 26], "multidimension": [14, 19], "multidisciplinari": 30, "multigr": [5, 28], "multim": 4, "multimap": 23, "multimod": [2, 5, 7, 9, 14, 16, 18, 24, 27, 28, 29, 30, 48, 49, 50], "multinomi": [13, 32], "multiom": [7, 9, 10, 11, 19, 27, 30, 34, 49], "multiome_donor_s4d8_pp_test": 10, "multiome_query_batch": 27, "multiome_reference_batch": 27, "multipl": [2, 3, 4, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 30, 34, 36, 41, 42, 48, 49, 51], "multiple_choice_quest": 42, "multipledispatch": 7, "multiplet": [11, 23, 48], "multiplex": [3, 7, 14, 15, 16, 23, 24, 25, 38, 39, 48, 50], "multipli": [17, 25, 38], "multipot": 5, "multiprocess": 16, "multiqc": 23, "multitask": 2, "multitud": 50, "multiva": 27, "multivari": 50, "multiview": 3, "mul\u00e8": 47, "mund": 29, "mundlo": 23, "munich": 30, "munsel": [7, 21], "munsell_0": [8, 25, 27, 28], "muon": [9, 11, 16, 18, 21, 28, 30, 43, 44, 45, 46, 47, 48], "muon_data": 10, "murnan": 50, "murphi": [14, 19, 29], "murrai": 36, "murrow": 23, "murthi": [5, 7, 50], "murugan": 1, "musculu": 49, "music_frac": 17, "music_prop": 17, "musicr": 17, "muskov": 23, "must": [1, 3, 4, 6, 7, 8, 13, 14, 16, 19, 21, 23, 24, 25, 49, 50, 51], "mustafah": 17, "mutat": [1, 2, 4, 23, 24, 25, 49], "mutation_prior": 49, "mutual": [1, 46], "muu": 7, "muxu": 49, "muzlifah": [25, 50], "mvi": 28, "mvtcr": 5, "mvtcr_embed": 3, "mx1": 25, "my_mudata": 19, "my_result": 19, "myadm": 8, "mycontrast": 14, "myelocyt": 5, "myeloid": [5, 12, 15, 17, 26, 36, 43], "myh10": 38, "myocardi": 36, "myocardium": 36, "myriam": 50, "myung": 25, "mzb1": [5, 12], "m\u00e4chler": 14, "m\u00fcller": 13, "n": [1, 2, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 31, 36, 37, 38, 41, 48, 49, 50, 51], "n1": 27, "n2": 27, "n_": [36, 38], "n_batch": [7, 36], "n_bg": 8, "n_cell": [1, 7, 11, 13, 14, 15, 19, 25, 28, 36, 37, 38, 49], "n_cells_by_count": [11, 19, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "n_cells_per_loc": 36, "n_cluster": 37, "n_comp": [5, 27, 33, 38], "n_compon": 19, "n_contig": 1, "n_count": [17, 27, 28, 36, 37, 43, 44, 45, 46, 47, 48], "n_extra_categorical_cov": [7, 36], "n_extra_continuous_cov": [7, 36], "n_feature_cutoff": 11, "n_features_per_cel": [10, 11], "n_gene": [3, 5, 14, 19, 25, 28, 36, 43], "n_genes_by_count": [11, 19, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "n_genes_detected_per_cel": 26, "n_hidden": [7, 16], "n_intbc": 49, "n_job": [3, 51], "n_label": [7, 36], "n_latent": [7, 16], "n_layer": [7, 16], "n_layers_decod": 27, "n_layers_encod": 27, "n_neighbor": [5, 13, 16, 17, 19, 26, 51], "n_ob": [1, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 50, 51], "n_our": 4, "n_out": 15, "n_pc": [6, 13, 19, 37, 44, 45, 50, 51], "n_perm": 40, "n_region": 28, "n_run": 3, "n_samples_per_group": 15, "n_subsampl": 16, "n_thread": 16, "n_top": 19, "n_top_gen": [3, 7, 13, 15, 17, 51], "n_topic": 8, "n_tss": [11, 19], "n_var": [5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 31, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 50, 51], "n_vdjdb": 4, "na": [1, 5, 7, 14, 15, 21, 25], "na_color": 5, "nabavi": 14, "nabhan": 7, "nabor_0": 8, "nabove2": 11, "nacho": 51, "nadel": 17, "nadhir": 16, "nadin": 36, "nadiya": 24, "nafissa": 16, "naftali": [5, 7, 25, 50], "nag00": 49, "nagai": [25, 36], "naghipourfar": [5, 16], "nagi": 49, "nagq": 14, "nahe": 49, "naiv": [1, 5, 7, 12, 14], "naived": 41, "najafabadi": 23, "nakano": 5, "name": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "namespac": [8, 15, 17, 25, 27, 28], "namit": 48, "namita": 1, "nan": [1, 2, 3, 4, 7, 17, 28, 34, 37, 41, 49], "nanami": 49, "nanargmin": 17, "nanjo": 49, "nannan": 4, "nano": 18, "nanobal": 37, "nanohol": 24, "nanolit": [2, 23, 24], "nanopor": 2, "naoki": 49, "nar": [2, 7, 9, 14, 25, 36, 38], "naranjo": 49, "naren": 24, "narrow": 23, "naruya": 49, "narwad": 9, "nat": [5, 8, 13, 14, 26, 30, 37, 41], "natali": 51, "natalina": 50, "natarajan": 24, "nath": 24, "nathan": [5, 7, 11, 14, 19, 23, 24, 25, 29, 50], "nathaniel": 2, "nation": [1, 4, 13, 15, 24, 51], "nativ": [11, 21, 23, 34, 49], "natmi": 25, "natsort": [1, 7, 15, 19, 21, 25], "nattermann": [17, 26], "natur": [1, 2, 3, 4, 5, 6, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 27, 28, 31, 33, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "nature14590": 50, "nature24489": [13, 22], "nau": [3, 4], "navarro": [11, 36], "nave": 40, "navig": 30, "nawijn": [5, 7, 50], "nax20": 1, "naxerova": 1, "nazaret": [7, 38], "nazor": [27, 28, 48, 50], "na\u00efv": 19, "nb": [4, 27, 28, 36], "nbclassic": 1, "nbformat": [1, 21], "nbinom_ufunc": [1, 7, 15, 21, 25], "nbmake": 26, "nbsp": 7, "nbt": [5, 6, 7, 24, 48, 50], "nc": [2, 3, 26], "ncam1": 27, "ncbi": 14, "ncell": 8, "ncf2": 8, "ncf_ufunc": [7, 15, 21, 25], "nchez": 26, "ncol": [1, 3, 8, 13, 14, 15, 27, 28, 36], "ncomms14049": [23, 24], "ncore": 8, "ncount_adt": 16, "ncount_gdo": 16, "ncount_hto": [16, 17], "ncount_rna": [14, 15, 16, 17, 25], "ncount_sct": [14, 15, 16, 25], "ncr1": 27, "nct_ufunc": 25, "ncx2_ufunc": 25, "nd": 4, "nd3": 7, "nd5": 7, "nd6": 7, "ndez": 16, "ndler": [17, 26], "ndownload": [2, 3, 5, 7, 15, 25, 31, 32, 33, 34, 36, 38, 43, 44, 45, 46, 47, 48], "ne": 23, "neal": 7, "nearest": [5, 6, 8, 13, 16, 23, 27, 34, 37, 50], "nearli": [11, 13], "necessari": [1, 2, 5, 7, 10, 13, 19, 21, 22, 23, 30, 45, 51], "necessarili": [5, 6, 13, 16, 18, 23, 24, 25, 34], "necessit": 23, "need": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 16, 17, 19, 21, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 40, 41, 48, 49, 50, 51], "needham": 5, "neeharika": 25, "neeraj": 15, "nef": 4, "neff": [7, 11, 27, 28, 34, 48], "neg": [2, 5, 8, 12, 13, 14, 15, 16, 17, 18, 23, 26, 28, 33, 36, 41, 47, 48], "neglect": [33, 41], "neglig": 4, "nehar": 11, "nei": 49, "neighbor": [3, 5, 6, 8, 11, 13, 15, 16, 17, 19, 21, 23, 26, 27, 31, 33, 34, 36, 37, 38, 40, 43, 44, 45, 49, 50, 51], "neighborhood": [3, 5, 7, 8, 13, 19, 31, 34, 37, 45, 49, 51], "neighbors_kei": 13, "neighbors_within_batch": 7, "neighbour": [6, 13], "neighbourhood": 34, "neighbouthood": 13, "neighor": 27, "neil": [13, 15], "nelson": 14, "nemanja": 24, "nemann": 15, "nematod": 49, "nemesh": [23, 24], "neocort": 24, "neocortex": 24, "neriman": 38, "ness": [23, 24, 50], "nest": [7, 13, 15, 28, 34, 48], "nested_model": 13, "net": [11, 27, 28, 34, 48], "network": [1, 3, 4, 5, 6, 7, 11, 15, 16, 19, 24, 25, 36, 37, 41, 49], "network_tutorial_rna_atac": 8, "network_tutorial_rna_n_atac": 8, "networkd3": [8, 11], "networkd3_0": 8, "networkx": [1, 27], "neu": 2, "neural": [5, 7, 11, 16, 27, 28, 34, 36, 41, 48, 51], "neurip": [6, 7, 8, 11, 27, 28, 34, 48], "neurips_2021": 27, "neurips_cite_pp": 27, "neurips_processed_input": 26, "neurips_processed_output": 26, "neurips_qc_filtered_allsamp": 10, "neurips_s1d1": 8, "neuron": [9, 16, 24, 36], "neutcount": 17, "neutral": 49, "neutralis": 4, "neutrophil": [5, 13, 17, 43], "neutrophils_1": 17, "neutrophils_2": 17, "neutrophils_3": 17, "neutrophils_4": 17, "neuwing": [17, 26], "never": [14, 25], "nevertheless": [1, 14, 25, 45, 47], "nevil": 16, "new": [3, 4, 5, 7, 8, 9, 11, 12, 13, 16, 18, 19, 23, 24, 26, 27, 28, 29, 30, 31, 34, 36, 38, 47, 48, 50], "new_": 27, "new_batch": 27, "new_donor": 27, "new_nam": 10, "new_ob": 15, "new_obs_column_nam": 27, "new_rank_zero_deprec": [7, 27, 28], "newbarcod": 2, "newcastl": [1, 2], "newcom": 30, "newer": [21, 22], "newli": [5, 11, 25, 29], "newman": 17, "newpag": 8, "next": [1, 2, 3, 4, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 31, 32, 34, 36, 37, 38, 39, 41, 48, 49, 51], "nextflow": [21, 23], "nextseq": 19, "neyman": 50, "nez": [49, 51], "nf": [16, 23], "nfeatur": 11, "nfeature_adt": 16, "nfeature_hto": [16, 17], "nfeature_rna": [14, 15, 16, 17, 25], "nfeature_sct": [14, 15, 16, 25], "nfeatures_atac": 8, "nfeatures_rna": 8, "nfia": 8, "nfib": 51, "nfrag": 11, "ng": 6, "ngai": 50, "ngene": [15, 26], "ngeneson": 14, "nghi": 24, "nghia": [5, 7, 44], "nghiem": 37, "ngn3": 51, "nguyen": [3, 4, 14, 15, 16, 24, 25, 37], "nh": 1, "nhlbi": 7, "nhood": 13, "nhood_adata": 13, "nhood_annot": 13, "nhood_annotation_frac": 13, "nhood_df": 13, "nhood_enrich": 40, "nhood_ixs_random": 13, "nhood_ixs_refin": 13, "nhood_kth_dist": 13, "nhood_neighbors_kei": 13, "nhood_retnlb_express": 13, "nhood_siz": 13, "nhu": 7, "nhuth": 14, "ni": [5, 7, 37, 50], "nice": [13, 49], "nicer": 11, "nich": [22, 25, 38], "nichenetr": 25, "nichenetr_1": 25, "nichol": [49, 51], "nichola": [2, 5, 7, 14, 16, 23, 24, 49, 50], "nick": [17, 24, 26], "nicki": 2, "nickola": 49, "nico": [17, 26, 37, 50], "nicol": [7, 9, 23, 50], "nicola": [17, 23, 50], "nicolai": 29, "nie": [25, 39, 41], "niebler": 23, "nielsen": [4, 14, 49], "nieto": [1, 2, 36], "nih": 14, "nik": 38, "nikaido": 24, "nikla": 3, "niklason": 25, "niknejad": 14, "niko": 14, "nikol": 5, "nikolai": [5, 7, 15, 16, 49, 50], "nikolao": 23, "nikolau": [6, 50], "nikoli": [7, 50], "nikolina": 1, "nil": [15, 25], "nili": 4, "nimh": 49, "nina": [1, 49], "nine": [24, 34], "ning": [13, 22, 23, 25, 26], "ninov": 49, "nir": [1, 4, 5, 6, 7, 9, 15, 24, 27, 28, 36, 38, 44, 49, 50, 51], "nirav": 2, "niro": 1, "nishimura": [23, 24], "nissen": [5, 14, 19, 27, 28], "nitin": 9, "nitish": 23, "nitzan": 38, "nk": [5, 7, 12, 15, 16, 25, 43], "nk_16hi": 1, "nk_cell": [14, 17], "nkain2": [5, 12], "nkg7": [5, 12, 19], "nkt": [5, 43], "nleimkuhl": 25, "nlm": 14, "nlme": [7, 21], "nlme_3": [25, 27, 28], "nmad": [34, 48], "nmeth": [7, 13, 14, 16, 19, 22, 23, 24, 41, 47, 48, 50], "nmf": 36, "nmi": [25, 28], "nmi_": 28, "nmi_al": 28, "nmi_clust": [7, 28], "nmi_max": 28, "nn": [8, 28], "nn_graph_gen": 37, "nn_graph_spac": 37, "nnerberg": [23, 24, 50, 51], "nnet_7": 25, "nnmat": 8, "nnstedt": 6, "nnz": [19, 33], "noah": 49, "nobuhiko": 49, "noc2l": 7, "node": [1, 3, 6, 13, 16, 18, 23, 25, 27, 49], "noga": [13, 22], "nois": [5, 6, 7, 11, 14, 16, 18, 23, 24, 25, 26, 27, 28, 31, 33, 41, 47], "noisi": [5, 25, 36, 51], "noisier": 48, "nolan": [4, 23, 24], "nolc1": 8, "nolegend": 27, "nolimits_": 41, "nomenclatur": 43, "nomin": 23, "non": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 23, 24, 27, 31, 32, 36, 41, 43, 47, 48, 49, 51], "non_covid": 2, "noncoval": 48, "none": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 17, 19, 25, 27, 32, 33, 36, 37, 40, 41, 42, 44, 45, 46, 47, 48, 49, 51], "nonetheless": [5, 23], "nonetyp": 21, "nonlinear": [33, 36], "nonspati": 41, "nonz_mean": 36, "nonz_mean_cutoff": 36, "nonzero": 13, "noqa": 27, "nor": [5, 22, 30], "norbert": [17, 26], "norm": [1, 7, 15], "norm_expr": 41, "norm_hist": 26, "norma": [7, 11, 27, 28, 34, 48], "normaeh23": 33, "normal": [1, 2, 5, 6, 7, 8, 11, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 31, 32, 34, 37, 38, 41, 45, 48, 49, 50, 51], "normalis": [7, 14, 15, 33, 36, 38], "normalize_pearson_residu": 33, "normalize_per_cel": [17, 19, 34], "normalize_tot": [5, 7, 14, 15, 16, 21, 25, 27, 33, 37, 50], "normalized_count": 36, "normalizedata": 27, "norman": 49, "normdor38": 33, "normfeatur": 11, "normgsr20": 33, "normoblast": [5, 7, 12], "noscript": 42, "notabl": [13, 22, 24, 33, 50, 51], "notat": [11, 51], "notconvertedwarn": 21, "note": [1, 2, 3, 4, 5, 9, 11, 12, 13, 16, 17, 19, 21, 25, 27, 28, 33, 34, 36, 38, 41, 48, 49], "notebook": [1, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 19, 21, 25, 26, 27, 28, 32, 34, 36, 37, 38, 41, 42, 48, 49, 50], "notebook_tqdm": [5, 6, 15, 50], "notic": [1, 2, 5, 7, 13, 19, 23, 24, 49], "notion": [23, 36, 49], "notori": 23, "noushin": 49, "nov": [1, 5, 13, 15, 17, 22, 24, 25, 31], "nove": 37, "novel": [3, 4, 11, 24, 25, 49, 50], "novemb": [6, 7, 9, 13, 23, 24, 26, 37, 38, 41, 50], "novo": 25, "novotni": 24, "now": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 44, 45, 46, 47, 48, 50], "nowadai": 24, "np": [1, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 32, 34, 37, 41, 44, 48, 49], "npc": [9, 28], "nppb": 36, "nproc": 1, "nprot": 24, "nr": 26, "nr1d1": 15, "nrgn": 41, "nrip1": [5, 12], "nrow": 8, "nrp1": 27, "ns_fail": 11, "ns_pass": 11, "nsbm_level_": 13, "nsbm_level_0": 13, "nsbm_level_1": 13, "nsbm_level_1_color": 13, "nsbm_level_2": 13, "nsbm_level_2_0": 13, "nsbm_level_2_1": 13, "nsbm_level_2_10": 13, "nsbm_level_2_11": 13, "nsbm_level_2_13": 13, "nsbm_level_2_14": 13, "nsbm_level_2_2": 13, "nsbm_level_2_3": 13, "nsbm_level_2_4": 13, "nsbm_level_2_6": 13, "nsbm_level_2_7": 13, "nsbm_level_2_8": 13, "nsbm_level_2_color": 13, "nsbm_level_3": 13, "nsbm_level_3_0": 13, "nsbm_level_3_1": 13, "nsbm_level_3_2": 13, "nsbm_level_3_3": 13, "nsbm_level_4": 13, "nsbm_level_4_0": 13, "nsbm_level_5": 13, "nsplice": 23, "nt": [16, 49], "nt5c3a": 14, "nt5dc3": 12, "nt5e": 27, "ntarget": 8, "nter": 7, "ntron": 23, "nu": 11, "nuc_signal_filt": 11, "nuc_signal_threshold": 11, "nuclear": [8, 9, 11, 24], "nuclei": [9, 11, 36], "nucleic": [4, 7, 9, 14, 15, 18, 24, 25, 26, 36, 38, 49], "nucleobas": 4, "nucleoid": 24, "nucleom": 11, "nucleosom": 9, "nucleosome_sign": [11, 19], "nucleosome_signal_upp": 11, "nucleotid": [1, 2, 9, 18, 23, 24, 49], "nucleu": [5, 9, 11, 18, 23, 24, 26, 36, 40], "null": [7, 8, 11, 13, 16, 21, 25, 27, 28, 32], "num": 37, "num_cells_thresh": 49, "num_epoch": 38, "num_not_miss": 49, "num_of_cell_per_donor": 14, "num_sampl": [13, 36], "num_thread": 23, "num_uncut": 49, "num_warmup": 13, "num_work": 26, "numba": [1, 5, 7, 13, 15, 21, 25, 26, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48], "numbadeprecationwarn": 5, "number": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 16, 17, 18, 19, 23, 24, 25, 26, 31, 32, 34, 36, 37, 38, 39, 40, 41, 46, 48, 50, 51], "number_dropped_intbc": 49, "number_observ": 19, "number_of_cutsit": 49, "number_of_edg": 27, "number_of_nod": 27, "number_of_sites_per_intbc": 49, "number_of_thread": 23, "number_vari": 19, "numcel": 49, "numcodec": 1, "numer": [1, 3, 4, 16, 23, 33], "numexpr": [1, 25], "numi": 26, "numpi": [1, 3, 4, 5, 7, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 30, 32, 34, 37, 44, 48, 49], "numpy2ri": [7, 28], "numpyro": 7, "numsaturatedtarget": 49, "nuniqu": [3, 49], "nurun": [19, 29], "nusbaum": 24, "nv": 11, "nvk": 4, "nx": 27, "nxm": 17, "nyquist": 7, "ny\u0155en": 24, "nzelmann": 15, "o": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 17, 21, 23, 25, 26, 28, 33, 34, 36, 50, 51], "o0": 26, "oas1": 25, "ob": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 43, 44, 45, 46, 47, 48, 49, 50, 51], "obenchain": [19, 22], "obj": [7, 15, 27, 50], "objc": [13, 21], "object": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 49, 50, 51], "obligatori": 7, "obs_": 19, "obs_column_nam": 27, "obs_df": [38, 41], "obs_meta": 19, "obs_nam": [11, 13, 14, 19, 21, 27, 28, 34, 46, 48, 49], "obs_to_keep": 14, "obscur": [7, 18], "observ": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 18, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "obsm": [5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 41, 43, 44, 45, 50, 51], "obsp": [5, 7, 13, 15, 19, 21, 27, 28, 36, 37, 38, 40, 41, 43, 44, 45, 51], "obtain": [1, 2, 4, 6, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 32, 33, 34, 36, 37, 38, 39, 45, 48], "obviou": [23, 24, 49], "occup": 24, "occupi": [8, 26, 49], "occur": [1, 2, 13, 17, 18, 23, 24, 25, 36, 40, 49], "occurr": [4, 23, 48], "oct": [5, 17, 23, 25, 30, 34, 48], "octet": 49, "octob": [6, 7, 8, 21, 23, 36, 43], "ocular": 7, "od": 51, "off": [2, 4, 8, 14, 23, 28, 36, 37], "offer": [2, 5, 16, 19, 22, 23, 30, 31, 39, 49, 51], "offic": 25, "offici": [1, 2, 3, 4, 21], "offset": 7, "ofir": [13, 49], "ofra": 36, "often": [0, 2, 3, 4, 5, 7, 9, 11, 13, 14, 17, 18, 19, 21, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 36, 38, 40, 49], "og": 47, "ogunjimi": 2, "ohler": 7, "oi": 8, "ok": [2, 4, 21, 49], "oka": 23, "okimoto": 49, "okuda": 5, "ol": [19, 22, 29], "olabi": 50, "olbtv": 29, "old": [1, 29], "older": 21, "oldest": 5, "oldformatwarn": 7, "olga": 49, "oligo": [16, 48], "oligonucleotid": [16, 18, 23, 24], "oliv": [5, 7, 14, 15, 17, 19, 24, 26, 28, 29, 36, 41, 48, 50], "oliva": 17, "olivar": 49, "oliveira": [7, 11, 27, 28, 34, 48], "olivi": [7, 24, 25], "olivia": [3, 4, 24, 40], "olkfm": 29, "oll": [19, 37, 40, 41], "oller": 17, "olsen": 24, "om": 16, "omer": [13, 22, 25, 36], "omic": [1, 2, 3, 7, 8, 15, 16, 17, 18, 19, 21, 22, 24, 26, 27, 36, 37, 39, 40, 41, 48, 49, 50], "omit": [14, 22], "omnipath": 15, "omnipathr": 25, "omp": [6, 13, 34], "omp_set_max_active_level": [6, 13, 34], "omp_set_nest": [6, 13, 34], "omri": 2, "on_": 28, "on_epoch_end": 28, "onc": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 16, 21, 23, 26, 34, 36, 38, 49], "onclick": 42, "oncogen": 49, "oncologi": 24, "ondrej": 43, "one": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 43, 46, 48, 49, 50, 51], "ones": [7, 11, 13, 15, 25, 32, 38, 45], "oneself": 15, "ong": 25, "ongo": [16, 22, 23, 25, 30], "onli": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 38, 39, 41, 44, 46, 48, 49, 50, 51], "onlin": [5, 8, 22], "onlinelibrari": [6, 13, 14, 24], "ono": 49, "onset_of_symptom": 17, "onto": [4, 7, 9, 13, 28, 29, 31, 36, 38, 49, 50, 51], "ontologi": 15, "oo_1": 8, "oob": 8, "ooi": 24, "oord": 26, "opc": 16, "open": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "openproblem": 27, "openproblems_bmmc_multiome_genes_filt": [7, 8, 26], "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistop": 8, "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistopic_npeak": 8, "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistopic_npeaks10000": 8, "openproblems_bmmc_multiome_genes_filtered_s1d1_ciscorr": 8, "openproblems_bmmc_multiome_genes_filtered_s1d1_ciscorr_npeak": 8, "openreview": [11, 27, 28, 34, 48], "openssl_2": 8, "oper": [4, 18, 19, 23, 25, 27, 51], "operatornam": 33, "opig": 4, "opinion": [17, 25, 50], "oppermann": 24, "opportun": [14, 30, 49], "oppos": 27, "opposit": [13, 21], "opt": [1, 6, 13, 17], "opt_einsum": 7, "opt_louvain": 28, "optax": 7, "optim": [3, 4, 5, 7, 11, 13, 15, 16, 17, 22, 23, 25, 31, 41, 49, 50], "optimis": 38, "optimizewarn": 41, "option": [2, 3, 4, 5, 7, 8, 10, 11, 13, 16, 17, 18, 19, 21, 23, 24, 25, 28, 37, 42, 49, 50], "options_html": 42, "or4f5": [19, 36], "orabi": 23, "oran": 50, "orang": [16, 23, 36, 49], "oravecz": 51, "orchestr": [19, 22], "order": [1, 2, 3, 4, 5, 7, 9, 13, 15, 16, 17, 18, 21, 23, 24, 25, 30, 31, 33, 34, 36, 38, 41, 49, 51], "order_ligand": 25, "order_target": 25, "orderbi": 25, "orderby_ascend": 25, "ordereddict": [11, 19], "ordinari": 51, "orf": 24, "org": [1, 2, 4, 5, 6, 9, 11, 13, 14, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "organ": [1, 2, 3, 4, 5, 7, 9, 11, 13, 16, 17, 18, 19, 23, 24, 25, 27, 28, 36, 38, 49], "organel": 24, "organis": 21, "organize_multiome_anndata": [27, 28], "organogenesi": [23, 37], "organoid": 13, "orient": [9, 49], "orig": [10, 16, 17], "origin": [1, 3, 4, 5, 7, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 27, 28, 31, 36, 37, 38, 42, 44, 49, 51], "originaldata": 17, "originalexp": [7, 27, 28], "orit": [5, 7, 13, 22, 24, 50], "orkin": 5, "ormerod": 13, "orphan": [2, 4], "orr": [7, 17, 50], "orthogon": [3, 9, 11, 13, 25, 31, 37, 38, 41, 50], "orthonorm": 31, "oscar": [7, 15], "oscil": 8, "oshlack": [7, 13, 23], "osnat": 24, "ostner": 13, "osx": 23, "ot": 49, "other": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 33, 34, 36, 38, 40, 43, 44, 45, 47, 48, 49, 50, 51], "other_d": 14, "otherchrom": 11, "otherwis": [1, 3, 4, 8, 13, 23, 27, 34, 36], "otto": 14, "ou": 37, "oudenaarden": [7, 31, 49, 50], "oup": [2, 4, 9, 14, 17, 19, 25, 36, 38], "our": [0, 1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 43, 44, 45, 46, 48, 49, 50, 51], "ourselv": [5, 15], "out": [2, 3, 4, 5, 8, 11, 13, 14, 16, 19, 23, 24, 25, 26, 30, 34, 37, 38, 41, 46, 48, 50, 51], "out_dir": 23, "outcom": [2, 11, 14, 17, 18], "outdat": [19, 22], "outer": 5, "outfile_prefix": 3, "outgrow": 49, "outlier": [5, 11, 14, 27, 28, 34, 37, 38, 43, 44, 45, 46, 47, 48, 49, 50, 51], "outlin": [15, 23, 30, 42], "outlook": [3, 47], "outnumb": [1, 26], "outpath_adj": 26, "outperform": [5, 6, 7, 15, 24, 33, 34, 36, 38], "output": [1, 2, 4, 5, 7, 8, 11, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 33, 34, 36, 42, 49], "output_clones_fil": 3, "output_data": 3, "output_dir": 23, "output_format": 23, "output_log": 3, "output_tcr": 3, "output_tessa": 3, "outsid": [8, 9, 11, 15, 16, 23, 49], "outstand": 33, "over": [1, 2, 3, 5, 7, 11, 13, 14, 15, 17, 19, 23, 24, 26, 30, 33, 34, 36, 41, 42, 48, 49, 50, 51], "overal": [1, 2, 3, 4, 5, 6, 7, 8, 11, 15, 16, 17, 22, 23, 24, 26, 28, 31, 36, 37, 39, 41, 49, 50], "overcom": [38, 49, 51], "overcorrect": [7, 34], "overcount": 23, "overcrowd": 1, "overdispers": 15, "overend": 48, "overfit": 16, "overflow": 42, "overhang": 23, "overhead": [21, 23], "overinterpret": 7, "overlai": 49, "overlaid": 7, "overlap": [1, 2, 4, 7, 8, 9, 11, 13, 15, 23, 26, 33, 38], "overlap_gen": 38, "overli": 23, "overload": [11, 19], "overloadeddict": [11, 19], "overlook": [7, 23, 25], "overrepres": [15, 23, 24], "overrid": [8, 21], "oversimplif": 25, "overview": [3, 5, 7, 11, 13, 14, 15, 16, 17, 22, 23, 25, 30, 37, 50], "overwhelm": 30, "overwrit": [8, 21, 27, 34], "overwritten": 21, "own": [1, 3, 5, 6, 11, 19, 23, 26], "ox": 4, "oxford": [2, 14, 24], "oxygen": [17, 24, 25], "oz": 37, "p": [5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 27, 28, 30, 34, 37, 40, 41, 42, 47, 48, 49, 50, 51], "p1": [11, 27, 33, 34, 36], "p10008": 6, "p17": 36, "p2": [11, 27, 33, 34], "p2rx1": 8, "p3": [11, 34], "p7": 36, "p8": 36, "p99": [5, 36], "p_g": 36, "p_val": 41, "paalb": 22, "paalhr22": 22, "pablo": [15, 50], "pacbio": 24, "pace": [29, 49], "pachter": [7, 23, 51], "pacif": 24, "pack": 9, "packag": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 25, 27, 28, 32, 33, 34, 36, 37, 40, 41, 48, 49, 50], "packer": 16, "paclik": [17, 26], "pad": [3, 42], "padj": 16, "pag": [19, 22], "paga": [6, 50], "page": [2, 3, 4, 7, 9, 15, 23, 30, 41, 49, 50], "pagerank": 25, "pagoda": 15, "pagoda2": 15, "pahbr": 22, "pahcg": 22, "pai": 49, "paid": 23, "pain": 24, "painless": 2, "pair": [1, 2, 3, 4, 7, 9, 15, 23, 24, 25, 27, 34, 36, 37, 38, 49, 50], "pair_to_plot": 1, "paired_integration_chapt": 28, "pairwis": [4, 7, 10, 13, 23], "pajukanta": 23, "palantir": 50, "palantir_branch_prob": 50, "palantir_branch_probs_cell_typ": 50, "palantir_diff_potenti": 50, "palantir_pseudotim": 50, "palett": [1, 11, 13, 25], "pall": 13, "palla": [5, 19, 25, 37, 40, 41], "palmotif": [1, 3], "palsson": 26, "palt19": 22, "pamela": 4, "pamp": 2, "pan": [4, 38, 49], "panagiota": 50, "pancrea": [17, 40, 51], "panda": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 30, 36, 38, 47, 48, 49], "pandas2ri": [1, 7, 11, 14, 15, 17, 27, 28, 32, 33, 34], "pandoc": [7, 8, 21], "panel": [5, 17, 23, 28, 36, 38, 47], "panel_s": [1, 4], "panglaodb": 15, "panizzolo": 13, "papadopoul": 2, "papadopoulo": 49, "papalexi": [5, 7, 14, 16, 19, 27, 28, 48, 50], "papalexi_2021": 16, "papasokrati": [8, 9], "papavasili": 1, "papen": [5, 7, 50], "paper": [3, 5, 7, 13, 14, 16, 22, 24, 39], "paradigm": 25, "parallel": [8, 21, 23, 24, 50], "parallel_4": [25, 27, 28], "parallelli": [7, 21], "parallelly_1": [25, 27, 28], "param": [4, 7, 13, 16, 21, 26, 38], "paramet": [1, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 33, 34, 36, 37, 41, 43, 44, 45, 46, 49], "parameter": [7, 36], "parameteris": 36, "parametr": 41, "parametris": 36, "params_experi": 3, "params_optim": 3, "parasail": 1, "parasit": 13, "paratop": 4, "parekh": [23, 24], "parent": [24, 49, 51], "pari": 42, "park": [5, 7, 29, 36], "parkinson": 51, "parp12": 25, "parp14": 25, "parp9": 25, "parri": 24, "pars": [15, 23], "parsabl": 1, "parsi": 5, "parsimoni": [23, 49], "parso": [1, 7, 15, 21, 25], "part": [0, 2, 3, 5, 6, 7, 9, 11, 14, 15, 16, 19, 21, 23, 25, 26, 27, 30, 36, 44, 48, 49], "partial": [5, 13, 15, 24, 25, 48, 51], "particip": [7, 24], "particular": [5, 6, 7, 13, 14, 16, 18, 19, 23, 25, 26, 28, 36, 49], "particularli": [5, 7, 14, 15, 17, 21, 22, 23, 27, 30, 36, 40], "partit": [5, 6, 33, 34, 49, 50], "partli": [5, 7, 36], "partner": 19, "parvalbumin": 24, "pascal": [5, 7, 24, 50], "pasquini": 5, "pass": [1, 2, 5, 7, 11, 14, 19, 21, 23, 24, 25, 27, 28, 36, 37, 41, 48, 49, 51], "past": [0, 23, 36, 49], "paste0": [8, 10, 14], "pat": 15, "patchwork": [7, 8, 11, 21], "patchwork_1": [8, 25, 27, 28], "patel": [2, 9, 49], "paten": 24, "path": [1, 2, 3, 4, 5, 8, 11, 15, 19, 21, 23, 26, 44, 45, 46, 47, 48, 49, 51], "path_bcr": [3, 4], "path_bcr_contig": 3, "path_bcr_input": [2, 3], "path_bcr_out": 2, "path_conga_clon": 3, "path_conga_gex": 3, "path_data": [1, 2, 3, 4], "path_gex": 1, "path_gex_bcr": 3, "path_gex_tcr": 3, "path_model": 3, "path_r": 3, "path_reduced_tcr": 3, "path_tcr": [3, 4], "path_tcr_csv": 2, "path_tcr_input": 2, "path_tcr_out": 2, "path_tmp": 3, "pathlib": [5, 15, 21, 26, 51], "pathogen": [2, 5], "patholog": 13, "pathologi": 4, "pathwai": [7, 14, 16, 25, 48], "patienc": 27, "patient": [1, 2, 3, 4, 14, 15, 16, 17, 25, 26, 36], "patient_1015_ctrl": 14, "patient_1015_stim": 14, "patient_1016": 14, "patient_1016_ctrl": 14, "patient_1016_stim": 14, "patient_101_ctrl": 14, "patient_1039": 14, "patient_1039_ctrl": 14, "patient_1039_stim": 14, "patient_107_ctrl": 14, "patient_107_stim": 14, "patient_1244_ctrl": 14, "patient_1244_stim": 14, "patient_1256": 14, "patient_1256_ctrl": 14, "patient_1256_stim": 14, "patient_1488": 14, "patient_1488_ctrl": 14, "patient_group": 36, "patient_id": [1, 2, 4], "patient_inform": 2, "patient_region_id": 36, "patricia": [16, 26], "patrick": [2, 5, 23, 37, 50, 51], "patro": [23, 51], "patsi": [1, 25], "pattern": [1, 2, 3, 5, 6, 13, 14, 15, 17, 23, 24, 25, 26, 34, 37, 38, 41, 49], "pau": 15, "pauciti": 23, "paul": [3, 4, 5, 7, 11, 14, 19, 22, 23, 24, 25, 27, 28, 29, 34, 37, 48], "paula": 36, "paulovich": 15, "pavana": 49, "pavel": 14, "pawel": [23, 24, 50], "pawlowski": 13, "pax5": [5, 10, 12], "paz": 16, "pb_data": 15, "pbappli": [7, 21], "pbapply_1": [25, 27, 28], "pbdzmq_0": 8, "pbmc": [2, 11, 14, 16, 19, 25, 26], "pbmc10k_multiom": 19, "pbmc3k": 19, "pbmcapply_1": 8, "pc": [5, 6, 7, 13, 14, 15, 21, 27, 28, 31, 37, 43, 45], "pc1": [15, 25], "pc2": 15, "pc_std": 44, "pca": [5, 7, 13, 14, 15, 16, 17, 19, 21, 26, 27, 28, 33, 34, 37, 38, 43, 50, 51], "pca_scatt": 31, "pca_variance_ratio": 45, "pcaproject": 27, "pcbi": 51, "pcf16": 1, "pcm": 50, "pcr": [2, 18, 23, 24], "pcr_batch": [7, 28], "pcsk2": 51, "pct_counts_hb": 34, "pct_counts_in_top_100_gen": [21, 37], "pct_counts_in_top_200_gen": [21, 37], "pct_counts_in_top_20_gen": 34, "pct_counts_in_top_500_gen": [21, 37], "pct_counts_in_top_50_gen": [21, 37], "pct_counts_mt": [21, 31, 34, 37], "pct_counts_ribo": 34, "pct_dropout_by_count": [11, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "pd": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 28, 38, 47, 48, 49], "pd1": 5, "pdata": 25, "pdc": [5, 7, 12, 17, 26], "pdcd1": 12, "pdf": [2, 3, 5, 6, 13, 14, 17, 19, 22, 23, 24, 27, 28, 29, 30, 33, 36, 38, 47, 48, 50], "pdl1": 16, "pdl2": 16, "pe": [5, 7, 23, 50, 51], "peak": [8, 9, 10, 11, 13, 19, 23, 28, 47, 48], "peak_annot": [11, 19], "peak_mask": 8, "peak_typ": [11, 19], "peakvi": 9, "pearson": [13, 23, 25], "pechlivani": 23, "pecht": [17, 26], "pechyron": 49, "peculiar": 14, "pedagog": [23, 37, 41], "peddada": 13, "pedro": [17, 25, 49], "peer": 6, "peggi": 25, "pei": 5, "peidli": [50, 51], "peisker": 36, "peiwen": 7, "peiyong": 7, "pekcan": 23, "pellegrini": 17, "pemoavdm": 16, "pemobdc": 16, "pemofmt": 16, "pemojlwt21": 16, "pemokst": 16, "pemolntw20": 16, "pemolsdd": 16, "pemolwt19": 16, "pemopmb": 16, "pemora": 16, "pemorsp": 16, "pemosgk": 16, "pemosh": 16, "pemosmfr": 16, "pemossg": 16, "pemossk": 16, "pemoszhl": 16, "pemowdw22": 16, "pemowmendezmp": 16, "pemoysl": 16, "pen_arg": 13, "penalti": [4, 23], "pendergraft": 24, "pendingdeprecationwarn": 7, "peng": [5, 7, 25, 37, 41, 50], "pengcheng": 37, "pengyi": 13, "penland": 7, "penn": 24, "peopl": [0, 7, 19], "peptid": [2, 4], "per": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 29, 33, 34, 36, 37, 38, 39, 48], "peral": 15, "perc": 38, "perceiv": [13, 25], "percellqcmetr": 21, "percent": [14, 16, 17, 49], "percent_mito": 36, "percent_top": [11, 19, 34, 48], "percent_uncut": 49, "percent_uniqu": 49, "percent_unique_thresh": 49, "percent_unsaturated_targets_thresh": 49, "percentag": [2, 11, 23, 34, 37, 49], "percentil": [5, 11, 23, 26], "percentuniqu": 49, "percentunsaturatedtarget": 49, "perceptron": 3, "perdigoto": 13, "perez": 25, "perfect": [4, 5, 11, 25], "perfectli": [7, 23], "perform": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 48, 49], "performancewarn": 5, "perhap": [19, 25, 49], "pericyt": 36, "period": 11, "peripher": [2, 14, 16, 19, 51], "peripheri": 9, "perman": 16, "permiss": [11, 34, 36, 48], "permit": 23, "permut": [16, 25, 40, 41], "permuted_results1": 16, "permuted_results2": 16, "pernil": 50, "persist": [19, 51], "person": [1, 11, 15, 25], "perspect": [1, 22, 29, 42, 50, 51], "pert_kei": 16, "pertin": 48, "pertpi": [13, 14, 16], "perturb": [1, 3, 7, 13, 15, 18, 24, 26, 29, 30, 48, 49], "perturbation_model": 16, "perturbation_signatur": 16, "peseski": 4, "peshkin": [24, 50], "peter": [1, 4, 5, 7, 14, 15, 16, 17, 19, 21, 23, 24, 27, 28, 36, 47, 48, 49, 50, 51], "peterson": [7, 48, 49], "petljak": 49, "petr": 15, "petra": 50, "pett": 50, "petti": 50, "pettu": [3, 4], "petukhov": [50, 51], "pexpect": [1, 7, 15, 21, 25], "pez": [5, 7], "pezzulo": 14, "pfeiffer": [17, 26], "pfigshar": 2, "pfrt22": 25, "pham": [24, 37], "phan": [2, 24], "phane": 24, "phantomj": [8, 11], "pharmacophor": 16, "phase": [2, 8, 13, 16, 18, 19, 30, 51], "phenodata": 17, "phenomenon": [1, 24], "phenotyp": [1, 2, 3, 5, 14, 15, 16, 18, 21, 51], "phi": 13, "philip": 3, "philipp": [2, 17, 19, 23, 26, 31, 49, 50, 51], "phillip": [16, 23, 24], "philpott": 24, "phipson": [7, 14, 15], "phosphodiest": 18, "phosphoryl": [9, 43], "photocleavag": 24, "phylodynam": 49, "phylogeni": [17, 49], "physic": [2, 8, 24, 25, 37], "physio": 3, "physiolog": [36, 46], "pi_": 36, "pia": 7, "picelli": 24, "pick": [3, 11, 13], "pickard": 50, "pickl": 21, "pickleshar": [1, 7, 15, 21, 25], "pictur": [13, 25, 48, 49], "piec": [1, 24, 48], "pierc": 9, "pierr": [7, 11, 15, 26, 32, 33, 34, 36], "pierson": 37, "pieter": [2, 23], "pietil": 23, "pii": [5, 9, 14, 17, 24, 25, 26, 27, 28, 30, 34, 39, 40], "pik3r5": 15, "pil": [1, 7, 15, 21, 25, 37], "pillar": [7, 21], "pillar_1": [8, 25, 27, 28], "pilzer": 36, "pimentel": 23, "pin": [7, 39], "pinchback": 15, "pinello": [11, 14], "ping": 2, "pink": 49, "pinpoint": 14, "pioneer": 7, "pip": [5, 6, 7, 13, 14, 15, 16, 19, 25, 26, 27, 28, 36, 37, 38, 40, 41, 49, 50, 51], "pipe": 23, "pipecomp": [32, 33, 34], "pipelin": [2, 3, 7, 9, 11, 14, 15, 16, 17, 18, 19, 21, 26, 32, 33, 34, 39, 50, 51], "pipet": 24, "piran": 49, "pircher": 13, "pird": 4, "pisco": [7, 11, 27, 28, 34, 48], "pisegna": 23, "pitfal": [4, 51], "pivot": 4, "pixel": 37, "pk": 25, "pkg_resourc": [1, 7, 15, 21, 25], "pkgconfig": [7, 21], "pkgconfig_2": [8, 25, 27, 28], "pkl": 5, "pkm": 25, "pl": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 28, 31, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 49, 50, 51], "place": [7, 19, 21, 23, 24, 25, 34, 38, 49, 51], "plagu": 25, "plai": [5, 17, 18, 19, 24, 49], "plan": [7, 11], "plan_kwarg": [5, 27], "plasma": [3, 5, 7, 12, 25, 43], "plasmablast": [3, 5, 12, 17], "plass": [6, 50], "plastic": 13, "plate": 2, "plateau": 8, "platelet": 5, "platform": [8, 15, 17, 18, 21, 23, 24, 25, 27, 28, 38, 49], "platformdir": [15, 21], "platypu": 2, "plaur": [5, 12], "plausibl": 25, "plcb1": [5, 12], "plcg2": [5, 12], "pleas": [1, 2, 3, 4, 5, 6, 7, 13, 14, 15, 19, 21, 23, 27, 28, 30, 34, 49, 50], "plethora": [25, 49], "plice": 23, "pliku": 25, "pliner": [5, 16], "plo": [1, 15, 23, 24, 51], "plot": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 19, 23, 25, 26, 28, 31, 32, 34, 36, 37, 40, 41, 45, 46, 48, 49, 51], "plot_barplot": 16, "plot_boxplot": 13, "plot_cell_annotation_sc": 38, "plot_da_beeswarm": 13, "plot_data_glob": 13, "plot_data_sampl": 13, "plot_dp_scatt": 16, "plot_draw_effect": 13, "plot_draw_tre": 13, "plot_edg": 13, "plot_effects_barplot": 13, "plot_effects_umap": 13, "plot_genes_sc": 38, "plot_heatmap": [14, 16], "plot_histori": 36, "plot_important_featur": 16, "plot_joint": 11, "plot_lda": 16, "plot_lollipop": 16, "plot_matplotlib": 49, "plot_milo_diagnost": 13, "plot_nhood_counts_by_cond": 13, "plot_nhood_graph": 13, "plot_perturbscor": 16, "plot_qc": 36, "plot_reg_mean_plot": 16, "plot_scatterplot": 16, "plot_spati": 36, "plot_stacked_barplot": 13, "plot_training_scor": 38, "plot_tss_max": 11, "plot_violin": 16, "plot_volcano": 25, "plotbcv": 14, "plotfigrheatmap": 8, "plotfigrnetwork": 8, "plotli": [7, 21], "plotly_4": [8, 25, 27, 28], "plotmarker2d": 8, "plotmd": 14, "plotnin": [1, 25], "plotsmear": 14, "plt": [1, 4, 5, 7, 11, 13, 14, 25, 26, 28, 32, 33, 36, 38, 49], "plu": 14, "plug": 49, "plugin": [5, 36], "plyr": [7, 21], "plyr_1": [8, 25, 27, 28], "plz22": 49, "pmbio": 21, "pmc4441768": 24, "pmcid": 24, "pmhc": [2, 4], "pmid": [4, 14], "pmlr": 7, "pna": [13, 24, 51], "png": [7, 21], "png_0": [8, 25, 27, 28], "po": [7, 44], "podoplanin": 45, "podxl": 38, "poe": 27, "pogson": 16, "poiding": 17, "point": [2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 18, 23, 25, 26, 30, 31, 33, 34, 36, 37, 39, 40, 47, 48, 49, 50, 51], "poirion": 7, "poisson": [13, 18, 19, 21, 24, 28, 36], "pola": 7, "polanski": [2, 5, 50], "poldsam": 23, "poli": [7, 19, 24], "polonski": 1, "polya": 23, "polyclip": [7, 21], "polyclip_1": [25, 27, 28], "polygyru": 13, "polyleven": 1, "polym": 18, "polymeras": 24, "polymercas": 18, "polymorph": 2, "polynomi": 49, "polysaccharid": 4, "pomeroi": 15, "ponc": 51, "pone": 24, "pont": 30, "pooch": [43, 44, 45, 46, 47, 48], "pool": [14, 18, 23, 29, 33], "poor": [7, 11, 16, 23, 24, 32, 34, 49], "poorer": 16, "pop": 2, "popescu": 50, "popul": [1, 2, 4, 7, 11, 13, 14, 15, 16, 17, 18, 21, 24, 25, 26, 31, 34, 43, 44, 45, 47, 48, 49, 51], "popular": [9, 13, 14, 19, 23, 24, 36, 37, 49, 51], "popviewport": 8, "pore": 9, "portabl": 24, "portal": 5, "portion": 23, "portrai": 17, "portrait": 51, "pose": [7, 17, 30, 47], "posit": [1, 2, 3, 4, 5, 8, 9, 11, 12, 13, 14, 15, 18, 23, 24, 25, 26, 33, 34, 39, 42, 47, 48, 51], "posixpath": 19, "possibl": [0, 1, 2, 4, 5, 7, 10, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 42, 43, 48, 49], "possibleuserwarn": 36, "possibli": [5, 13, 15, 25, 51], "post": [5, 16, 23, 25, 30, 49], "post_sample_q05": 36, "posterior": [16, 23, 36, 49], "postmortem": 24, "potenti": [2, 6, 8, 14, 16, 18, 19, 22, 23, 24, 26, 29, 31, 34, 38, 39, 46, 49], "potential_ligand": 25, "pour": 7, "powel": [5, 7, 23, 50], "power": [2, 13, 14, 15, 16, 24, 43, 49], "powerlaw_0": 8, "poyner": 50, "pp": [1, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 44, 45, 47, 48, 49, 50, 51], "pp_adata": 38, "ppbp": 19, "ppp1r1a": 51, "ppr": 25, "pr": 14, "pracma_2": 8, "practic": [3, 7, 13, 14, 15, 16, 17, 19, 23, 25, 31, 33, 34, 37, 49, 50, 51], "pradyot": [3, 4], "pragmat": 16, "prashant": 49, "pratap": 24, "pratiksha": [16, 48, 50], "pratip": [16, 47, 48, 50], "pratt": 49, "prdm1": [5, 12], "prdm16": 12, "pre": [0, 1, 3, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 23, 25, 26, 27, 28, 37, 40, 41, 50, 51], "precalcul": 26, "preced": 25, "precis": [4, 5, 13, 14, 15, 23, 49], "precursor": [5, 24, 50, 51], "pred": [16, 37], "predat": 23, "predecessor": 51, "predefin": [5, 15, 39], "predict": [3, 5, 7, 11, 13, 17, 18, 23, 26, 27, 28, 34, 36, 37, 38, 48, 49], "predict_differential_priorit": 16, "predict_ligand_act": 25, "predicted_adt": 27, "prediction_label": 3, "predictions_high": 5, "predictions_high_adata": 5, "predictions_low": 5, "predictions_low_adata": 5, "predictor": [2, 17], "predominantli": 7, "preetish": [5, 7, 50], "prefer": [1, 6, 7, 11, 19, 24, 34], "preferenti": [1, 24], "prefix": [7, 19, 34, 36], "prefront": 16, "preissl": 9, "preliminari": [8, 33], "premis": [3, 38], "prep": 25, "prep_anndata": 14, "prepar": [2, 5, 13, 18, 19, 24, 36], "prepare_ligand_target_visu": 25, "preparebridgerefer": 27, "prepend": 36, "preprint": [16, 49], "preprocess": [2, 5, 6, 7, 8, 9, 11, 13, 15, 19, 23, 26, 27, 28, 30, 31, 32, 33, 34, 38, 48, 49, 50], "prerequisit": 9, "preselect": 38, "presenc": [3, 26, 33, 40, 46], "present": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 15, 16, 17, 18, 21, 23, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 43, 47, 48, 49], "preserv": [3, 4, 6, 7, 15, 23, 28, 31, 32, 33, 39, 42, 50], "press": [31, 50], "presto": 1, "presum": 49, "prete": 5, "pretend": 7, "pretrain": [3, 27], "pretti": 19, "preval": [13, 23], "prevent": [5, 11, 15, 16, 38], "previou": [1, 3, 4, 5, 7, 8, 9, 11, 15, 16, 19, 23, 26, 28, 45, 49], "previous": [1, 2, 3, 4, 5, 7, 14, 16, 19, 23, 25, 26, 29, 31, 34, 37, 38, 49], "prf1": [8, 12], "prigmor": [25, 50], "priluski": 4, "primari": [3, 4, 11, 13, 16, 18, 19, 21, 30, 49], "primarili": [16, 19, 23, 24, 30, 41, 49], "primary_complaint": 17, "primary_nt_allele_t": 49, "primary_nt_tumor": 49, "primary_onli": [1, 3, 4], "prime": [23, 24], "primer": [18, 24, 50], "primerid": 14, "princeton": 31, "princip": [6, 14, 16, 19, 31, 33, 34, 45, 50], "principl": [5, 7, 9, 11, 13, 16, 33, 34, 37, 50], "print": [2, 3, 4, 5, 7, 8, 11, 14, 19, 21, 23, 26, 34, 38, 48, 49], "print_head": [1, 19], "print_vers": 1, "prior": [5, 9, 11, 14, 15, 16, 17, 19, 23, 24, 26, 27, 28, 30, 36, 38, 49, 50, 51], "priori": [15, 45, 47, 51], "priorit": 25, "prioriti": [7, 8], "pritchard": 5, "privat": 1, "privet": 1, "privileg": 1, "prkce": [5, 12], "prkcq": 8, "prlic": 14, "pro": [3, 5, 23], "prob": [13, 37], "probabilist": [5, 7, 23, 27, 28, 36, 38, 49, 50], "probability_threshold": 49, "probabl": [1, 4, 7, 8, 13, 16, 18, 23, 25, 31, 36, 37, 38, 40, 48, 49, 50], "probe": [2, 24], "problem": [1, 4, 5, 6, 7, 8, 13, 14, 15, 18, 23, 29, 30, 31, 36, 38, 40, 49], "problemat": [2, 23], "proc": 50, "proc_1": 25, "proce": [14, 15, 19, 49, 50], "procedur": [7, 14, 15, 16, 23, 27, 38, 49, 50, 51], "proceed": [1, 4, 7, 13, 15, 24, 51], "process": [0, 1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 25, 26, 27, 28, 29, 30, 32, 34, 37, 38, 39, 40, 41, 44, 48, 49, 50, 51], "processx_3": 8, "prodlim_2019": 25, "produc": [1, 2, 3, 7, 13, 22, 23, 24, 25, 26, 30, 31, 34, 49, 51], "product": [1, 8, 11, 15, 25, 27, 28], "productive_b_vdj": 1, "productive_b_vj": 1, "productive_vdj": 1, "productive_vj": 1, "proerythroblast": [5, 7, 12], "profession": 30, "profil": [1, 3, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 23, 24, 25, 26, 30, 31, 32, 34, 36, 38, 41, 47, 48, 49, 50, 51], "prog": [5, 7, 12], "progeni": 15, "progenitor": [5, 12, 13, 25, 49], "program": [1, 8, 15, 16, 19, 21, 23, 30, 31, 49], "progress": [1, 5, 14, 17, 18, 29, 30, 48, 49, 50], "progressbar": [44, 45, 46, 47, 48], "progressr": [7, 21], "progressr_0": [25, 27, 28], "prohibit": 16, "project": [3, 7, 8, 10, 11, 16, 19, 21, 23, 24, 27, 30, 31, 34, 38, 49, 50, 51], "project_cell_annot": 38, "project_gen": 38, "prokaryot": [24, 26], "prol": 17, "prolif": 5, "prolifer": [1, 2, 3, 17], "prom1": [5, 12], "prometheus_cli": [1, 21], "promin": [7, 13], "promis": [7, 15, 16, 17, 21, 30, 36, 49], "promises_1": [8, 25, 27, 28], "promot": [8, 11, 18, 21, 26, 49], "promotor": 24, "prompt": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "prompt_toolkit": [1, 7, 15, 21, 25], "promyelocyt": 5, "prone": [2, 14, 17], "pronounc": [44, 51], "prop": [13, 25], "prop_shared_cel": 28, "propag": 25, "propens": 49, "proper": [5, 7, 8, 15, 18], "properit": 49, "properli": [1, 7, 13, 14, 15, 19, 21, 23, 24, 26], "properti": [1, 2, 3, 4, 6, 13, 14, 16, 23, 24, 34, 38, 47], "proport": [1, 13, 17, 24, 25, 34, 36, 39, 49], "propos": [6, 9, 13, 17, 23, 25, 31, 32, 34, 41, 50, 51], "prospect": 49, "prospon": 4, "prot": [16, 19, 21, 44, 45, 46, 47, 48], "prot_": [21, 28], "prot_filtered_feature_bc_matrix": 48, "prot_raw": 48, "prot_raw_feature_bc_matrix": 48, "prot_var": 27, "protect": 2, "protein": [1, 2, 4, 5, 7, 8, 9, 11, 16, 17, 18, 19, 24, 25, 27, 28, 30, 34, 36, 43, 44, 45, 46, 47, 48, 50], "protein_count": 27, "protein_express": 28, "protein_expression_obsm_kei": [27, 28], "proteom": [24, 25, 39], "protocol": [2, 7, 9, 16, 18, 19, 23, 25, 34, 36, 48, 49, 50, 51], "protocoldata": 17, "prototyp": 36, "protpca": 21, "protpca_1": 21, "protumap": 21, "protumap_1": 21, "proud": 0, "prove": 34, "proven": 49, "provid": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 30, 31, 32, 34, 36, 37, 38, 39, 40, 41, 43, 48, 49, 50], "provok": 26, "proxi": [3, 8, 13, 16, 25, 48], "proxim": [5, 8, 9, 16, 25, 37, 40, 50], "proxy_0": 25, "prr": 2, "prtn3": 12, "prudent": 7, "prune": [3, 7, 23, 26], "prusti": 50, "pryhub": 5, "ps02": 1, "ps_1": 8, "pseudo": [1, 14, 25, 32, 33], "pseudo_metr": 3, "pseudoalign": 23, "pseudobulk": 25, "pseudocount": 13, "pseudorepl": 14, "pseudotempor": 18, "pseudotim": [18, 19], "psomopoulo": 23, "pst": 42, "psutil": [7, 15, 21], "pt": [3, 5, 13, 16], "ptbbdb": 50, "ptblp": 50, "ptbskt21": 50, "ptbwl": 50, "ptbww": 50, "ptcggr": 50, "ptch1": 8, "ptdc": 50, "ptebk": 50, "ptesl": 50, "pth": 15, "pthbuttnerw": 50, "pthl": 50, "pthlb18": 50, "ptikjallquistm": 50, "ptjwg": 50, "ptllo82": 50, "ptmac67": 50, "ptmlc": 50, "ptmsz": 50, "ptmullner11": 50, "ptpr": 12, "ptpr02": 50, "ptprc": 25, "ptqhq": 50, "ptsh": 50, "ptskl": 50, "ptsrf": 50, "ptssz": 50, "ptt": 49, "pttwve19": 50, "ptwhp": 50, "ptwry16": 50, "ptyprocess": [1, 7, 15, 21, 25], "pu": 49, "public": [1, 3, 4, 5, 7, 11, 13, 14, 16, 28, 36, 49, 50, 51], "publicli": [5, 7, 19, 21, 23, 49], "publish": [2, 3, 5, 6, 9, 15, 33, 36, 49], "pubm": 14, "pui": 37, "pulendran": 2, "pull": [21, 25, 27, 28], "pulliam": 37, "pullin": 5, "puls": 2, "pump": 51, "punctual": 1, "pura": 37, "purdom": 50, "pure": [11, 13, 37], "pure_ev": [7, 15, 21, 25], "purif": 17, "puriti": 3, "purpl": [13, 49, 51], "purpos": [4, 5, 6, 7, 8, 9, 13, 15, 16, 19, 25, 26, 36, 37, 38, 41, 44, 49], "purrr": [7, 21, 25], "purrr_1": [8, 25, 27, 28], "pursu": 16, "purushothama": [5, 7, 50], "pushviewport": 8, "put": [0, 1, 5, 8, 14, 23, 26, 36, 38, 49, 50], "puwen": 25, "pval": [13, 14, 15, 16, 25, 41], "pval_adj_col": 14, "pval_col": 14, "pval_norm": 41, "pval_norm_fdr_bh": 41, "pvals_adj": 14, "pvalu": [13, 14, 15], "pvalz": 8, "pvectorc": 1, "pw_alpha": 4, "pw_beta": 4, "px": 42, "py": [1, 3, 4, 5, 6, 7, 11, 15, 17, 19, 21, 25, 27, 28, 34, 36, 37, 41, 49, 50], "py2rpi": 21, "py_builtin": 21, "py_object": 21, "pyarrow": 1, "pycpars": [7, 15, 25], "pydata": [1, 21], "pydev_ipython": [1, 7, 15, 21, 25], "pydevconsol": [1, 7, 15, 21, 25], "pydevd": [1, 7, 15, 21, 25], "pydevd_concurrency_analys": [1, 25], "pydevd_file_util": [1, 7, 15, 21, 25], "pydevd_plugin": [1, 7, 15, 21, 25], "pydevd_trac": [1, 7, 15, 21, 25], "pygment": [1, 7, 15, 21, 25], "pynndesc": [5, 7, 15, 19, 26], "pyobjctool": 21, "pypars": [1, 7, 15, 21, 25], "pypi": [1, 19], "pyplot": [1, 4, 5, 7, 11, 13, 14, 25, 26, 28, 32, 33, 38, 49], "pyramid": 41, "pyramidal_lay": 40, "pyro": [7, 23], "pyrophosph": 24, "pyrosequenc": 24, "pyrsist": 1, "pyscen": 26, "pyscenic_aucell_stdout": 26, "pyscenic_ctx_stdout": 26, "python": [1, 2, 3, 4, 5, 6, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "python3": [1, 4, 5, 6, 7, 11, 15, 19, 21, 25, 27, 28, 34, 36, 37, 41, 50], "python38": 17, "python_h5mu_fil": 21, "pythonjsonlogg": 21, "pythonwarn": 16, "pytoml": 1, "pytorch": [5, 16], "pytorch_lightn": [4, 7, 27, 28, 36], "pytz": [1, 7, 15, 21, 25], "pytz_deprecation_shim": [7, 15, 25], "pzp": 38, "p\u0227l": 24, "q": [2, 3, 4, 7, 8, 11, 13, 14, 15, 16, 25, 26, 42], "q0": 8, "q05_cell_abundance_w_sf": 36, "q05_per_cluster_mu_fg": 36, "q1": 42, "q95_per_cluster_mu_fg": 36, "q_model": 27, "qaiser": [14, 16], "qc": [5, 19, 21, 23, 25, 26, 34, 49], "qc_var": 34, "qcgsr20": 34, "qclbc": 34, "qcmed": [7, 27, 28], "qcxl21a": 34, "qcxl21b": 34, "qcyb20": 34, "qcyck": 34, "qczt21": 34, "qerc18": 47, "qi": [3, 5, 7, 15, 50], "qian": [26, 37], "qiang": 5, "qiao": [2, 7, 51], "qiaonan": 15, "qiaozhen": 49, "qime": 24, "qin": 37, "qing": [25, 37, 39, 41], "qingm": 2, "qingtai": 4, "qiu": [23, 37, 50], "qiuyu": 26, "qivltqspsslavsvgekvtlsckssqsllysnnqknylawyqqk": 4, "qjo": 49, "qlf": [13, 14], "qo": 23, "qpcr": [18, 24], "qqhystpyt": 4, "qqyytypwt": 4, "qu": [36, 38], "quad": [36, 38], "quadrant": 11, "quadrat": 33, "quak": 24, "qualit": [9, 13, 16], "qualiti": [3, 4, 5, 7, 9, 14, 17, 18, 19, 24, 25, 28, 29, 33, 36, 38, 47, 51], "quan": [15, 37], "quanshui": 37, "quant": 23, "quant_dir": 23, "quant_out_dir": 23, "quantaf": 23, "quantif": [1, 5, 7, 48, 51], "quantifi": [1, 2, 3, 4, 5, 7, 8, 13, 14, 16, 21, 23, 24, 25, 26, 29, 32, 39, 40, 41, 48, 50], "quantil": [11, 17, 23, 26, 36, 51], "quantit": [7, 9, 16, 18, 23, 24, 28, 40, 49, 51], "quantiti": [2, 18, 23, 24], "quantiz": 50, "quants_mat": 23, "quants_mat_col": 23, "quants_mat_row": 23, "quarto": 21, "quartz": [17, 24], "quasi": [7, 14, 23], "queen": [7, 50], "quentin": [14, 16], "queri": [2, 3, 5, 7, 15, 23, 28, 48], "query_adata": 5, "query_adata_emb": 5, "question": [3, 4, 7, 9, 13, 15, 19, 21, 23, 24, 25, 30, 39, 42, 50], "question_id": 42, "quick": [7, 11, 15, 19, 23], "quickli": [7, 8, 21, 51], "quickstart": 19, "quickstart_mudata": 19, "quiescent": 34, "quiet": 27, "quietli": 8, "quinn": [47, 49], "quiroga": 50, "quit": [1, 5, 7, 17, 21, 28, 36, 37, 49], "quitz": 50, "qval": 41, "qvqlqqpgtelvnpgaslkmscktsgyrftsyiihwvkqtpgqgl": 4, "qvqlqqsgaelarpgasvklsckasgypftsyginwvkqrtgqgl": 4, "r": [1, 2, 3, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 47, 49, 50], "r0": [8, 15, 25, 27, 28], "r1": 49, "r10": 49, "r11": 49, "r12": 49, "r13": 49, "r14": 49, "r15": 49, "r16": 49, "r17": 49, "r18": [24, 49], "r2": [23, 49], "r25": 13, "r2_valu": 16, "r2d3": [8, 11], "r2d3_0": 8, "r2py": [7, 11], "r3": 49, "r4": 49, "r5": 49, "r6": [7, 21, 49], "r6_2": [8, 25, 27, 28], "r7": 49, "r8": 49, "r80__10kb_up_and_down_tss": 26, "r9": 49, "r_lib": 3, "r_object": 21, "r_to_pi": 21, "r_x": 23, "r_y": 23, "ra": 33, "raab": [17, 26], "rabinov": 7, "rachael": [24, 48], "rachel": [1, 2, 4, 7, 25, 49, 50], "raczkowski": 14, "radich": [23, 24], "radii": 40, "radio": 42, "radioact": 24, "radiolabel": 24, "radiu": [40, 42], "radmila": 24, "radu": 11, "raether": 29, "rafael": [14, 19, 22, 32, 36], "rafiqul": 50, "rage": 2, "raghav": 38, "raghubar": 37, "ragoussi": 23, "rahbari": 49, "raheleh": 49, "rahmani": [5, 23], "rahul": [5, 7, 9, 14, 15, 16, 19, 23, 24, 27, 28, 47, 48, 50], "rai": 14, "rainbow": 5, "raindrop": 23, "rainer": [24, 50], "rais": [1, 23], "raj": 49, "rajagop": [5, 7, 50], "rajewski": [6, 50], "rajiv": [23, 24], "raktima": [13, 22], "ralf": 23, "ralph": [9, 23], "ram": [5, 26], "ramachandran": 50, "ramakrishna": 49, "ramani": 16, "rambow": [15, 26], "ramilowski": 25, "ramirez": [7, 15, 25, 36, 50], "ramnik": [13, 22], "ramo": 25, "ramona": 36, "ram\u00edrez": [43, 44, 45, 46, 47, 48], "ran": [5, 7, 14], "rand": 31, "randel": 5, "randi": 4, "random": [1, 2, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 37, 49, 50], "random_3": [25, 27, 28], "random_forest_classifi": 16, "random_forest_regressor": 16, "random_se": 13, "random_st": [3, 11, 13, 15, 16, 19], "randomforest": 25, "randomforest_4": 25, "randomli": [1, 11, 16, 19, 21, 23, 24, 34], "randomst": 15, "rang": [5, 7, 9, 11, 13, 14, 16, 19, 21, 22, 23, 24, 25, 30, 33, 38, 44, 46, 47, 48, 49, 50], "ranger": [2, 3, 4, 9, 23, 37, 40, 41, 48], "rani": [24, 37], "rank": [5, 8, 13, 14, 15, 16, 23, 25, 26, 28, 31, 32, 36, 43, 50], "rank_aggreg": 25, "rank_genes_group": [3, 5, 14, 15, 16, 21, 37, 43], "rank_genes_groups_df": [14, 15], "rank_genes_groups_dotplot": [5, 43], "rank_zero": [7, 27, 28], "rank_zero_deprec": [7, 27, 28], "rank_zero_experi": [7, 27, 28], "rank_zero_warn": 36, "rankbi": 8, "rankdriv": 8, "rann": [7, 21], "rann_2": [25, 27, 28], "rao": [5, 7, 50], "raphael": [2, 5, 14, 19, 22, 27, 28, 37, 47, 48], "rapid": [2, 5, 23, 25, 29, 51], "rapidli": [2, 37], "rapmap": 23, "rare": [7, 9, 11, 14, 16, 17, 23, 24, 33, 34], "rare_ct_cut_off": 17, "raredon": 25, "rasa": 36, "rashel": 24, "rasmu": 49, "rat": [45, 47], "ratcliff": 14, "rate": [1, 13, 14, 17, 18, 23, 24, 25, 26, 27, 28, 36, 49, 51], "ratg13": 4, "rather": [3, 4, 5, 6, 7, 13, 15, 16, 19, 21, 23, 24, 25, 26, 31, 34, 36, 38], "ratio": [7, 11, 14, 18, 23, 26, 34, 41, 51], "ration": [4, 16], "raul": 25, "rautenstrauch": 7, "rautio": [23, 24], "ravel": [13, 49], "raw": [0, 1, 3, 5, 7, 8, 11, 14, 15, 18, 19, 21, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 41, 45, 47, 48, 49, 51], "raw10xgenomics21": 23, "raw_clonotype_id": 2, "raw_consensus_id": 2, "raw_feature_bc_matrix": 34, "rawarj": 23, "rawbfl": 23, "rawbk19": 23, "rawbpmp16": 23, "rawbruningt": 23, "rawbt": 23, "rawbwc": 23, "rawcpm92": 23, "rawcsq": 23, "rawdd": 23, "rawdsc": 23, "rawfar07": 23, "rawfdf": 23, "rawgp21": 23, "rawhfw": 23, "rawhwc": 23, "rawhz": 23, "rawizj": 23, "rawkyd21": 23, "rawli18": 23, "rawlin": 50, "rawlra": 23, "rawmb": 23, "rawmbl": 23, "rawmmg19": 23, "rawmp21": 23, "rawmsmme20": 23, "rawnmullerhs20": 23, "rawoem": 23, "rawphj": 23, "rawppc": 23, "rawpzv": 23, "rawrs00": 23, "rawshs17": 23, "rawsk18": 23, "rawsm": 23, "rawssgp16": 23, "rawssps21": 23, "rawtmp": 23, "rawwlk19": 23, "rawwoz97": 23, "rawyb20": 23, "rawyt": 23, "rawzhhjs22": 23, "rawzswm00": 23, "rawzt21": 23, "rawztb": 23, "raybould": 4, "raychaudhuri": [5, 7, 44], "raychowdhuri": [13, 22], "raymond": 49, "raz": 49, "rbd": 4, "rc": 11, "rc_context": [13, 36], "rcb": [32, 33, 34], "rcistarget": [8, 11], "rcistarget_1": 8, "rcolorbrew": [7, 21], "rcolorbrewer_1": [8, 25, 27, 28], "rcparam": [1, 4], "rcparamsdefault": 1, "rcpp": [7, 21], "rcpp_1": [8, 15, 25, 27, 28], "rcppannoi": [7, 21], "rcppannoy_0": [25, 27, 28], "rcpphnsw_0": 27, "rcsb": 4, "rctd": 36, "rcurl": [7, 21], "rcurl_1": [8, 15, 27, 28], "rd": [8, 25, 27, 28], "rdata": 3, "rdb": 3, "rdpu": 36, "re": [3, 4, 7, 11, 13, 14, 15, 21, 26, 30, 31, 34, 37, 38], "reach": [3, 5, 6, 7, 9, 24, 27, 28, 36, 37, 51], "react": [2, 16, 25], "reaction": [3, 4, 18, 24], "reactiv": [2, 3], "reactom": 15, "reactome_ddx58_ifih1_mediated_induction_of_interferon_alpha_beta": 15, "reactome_interferon_alpha_beta_sign": 15, "reactome_interferon_gamma_sign": 15, "reactome_interferon_sign": 15, "reactome_interleukin_6_sign": 15, "reactome_ion_channel_transport": 15, "reactome_leishmania_infect": 15, "reactome_mhc_class_ii_antigen_present": 15, "reactome_mrna_splicing_minor_pathwai": 15, "reactome_neutrophil_degranul": 15, "reactome_pathwai": 15, "reactome_platelet_activation_signaling_and_aggreg": 15, "reactome_rrna_process": 15, "reactome_signaling_by_interleukin": 15, "reactome_transl": 15, "read": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 15, 17, 18, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 38, 41, 43, 44, 45, 46, 47, 48, 49, 51], "read2": 23, "read_10x_h5": [11, 34, 48], "read_10x_vdj": 2, "read_csv": [2, 3, 4, 5, 17, 26, 49], "read_elem": [7, 19], "read_h5ad": [7, 11, 19, 21, 26, 49], "read_h5mu": [21, 48], "read_layers_to_assai": 10, "read_lengh": 23, "read_length": 23, "readabl": 16, "readbitmap_0": 8, "readcount": 49, "reader": [2, 13, 19, 21, 22, 23, 25, 27, 30, 33, 36, 37, 39, 49], "readh5ad": [8, 21], "readh5mu": [10, 21], "readi": [11, 23, 24, 47, 50], "readili": [23, 38, 51], "readm": 1, "readout": [8, 16, 19, 24, 26, 36, 49], "readr_2": [8, 25], "readrd": [8, 25, 27], "reads1": 23, "reads1_fil": 23, "reads1_pat": 23, "reads2": 23, "reads2_fil": 23, "reads2_pat": 23, "reads_in_peaks_frac": 11, "readthedoc": [5, 6, 15, 19, 27, 49, 50], "reagent": [24, 48, 49], "real": [7, 13, 15, 16, 18, 19, 24, 26, 29, 36, 51], "realist": [15, 49], "realiti": [5, 19, 29, 49], "realiz": 19, "realli": [13, 16, 26, 38], "realm": 49, "reanalysi": 29, "reap": 48, "rearrang": 1, "rearrangement_statu": 1, "rearrangement_status_vdj": 1, "rearrangement_status_vj": 1, "reason": [5, 7, 8, 11, 17, 18, 19, 21, 23, 26, 30, 34, 36, 38, 49, 51], "reassess": 34, "reassign": 23, "rebecca": [13, 22, 24, 36], "rebekka": [25, 36], "recal": 4, "recalcul": [16, 27], "recapitul": [40, 49], "receiv": [1, 3, 4, 9, 16, 23, 49], "receiver_celltyp": 25, "receiver_express": 25, "recent": [2, 3, 4, 5, 7, 13, 14, 15, 16, 19, 21, 23, 25, 27, 28, 30, 33, 49, 50, 51], "receptor": [1, 3, 4, 18, 19, 24, 49], "receptor_arm": [1, 3, 4], "receptor_complex": 25, "receptor_mean": 25, "receptor_prop": 25, "receptor_subtyp": [1, 2], "receptor_typ": [1, 2], "receptorn": 25, "rechavi": 51, "reciev": 3, "recipes_1": 25, "reciproc": 13, "recogn": [2, 3, 4, 5, 13, 26, 30], "recognit": [1, 2, 3, 4], "recombin": [1, 14], "recombinas": 49, "recombinatori": 2, "recommend": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 29, 30, 36, 37, 41, 44, 45, 49, 51], "recomput": [13, 15], "reconcil": [6, 26, 50], "reconstruct": [2, 7, 16, 27, 36, 50], "reconstruction_loss_valid": 28, "record": [1, 16, 23, 25, 27, 28, 49, 50], "recov": [2, 8, 16, 23, 24, 26, 38, 49, 51], "recover_dynam": 51, "recoveri": [17, 18, 23, 24, 49], "recreat": 31, "recruit": 9, "rectangl": 36, "recurr": 23, "red": [5, 11, 13, 14, 16, 23, 24, 26, 42, 49], "redetzki": [17, 26], "redirect": 23, "reduc": [1, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 18, 21, 23, 24, 25, 27, 28, 31, 32, 34, 36, 38, 41, 45, 50, 51], "reduce_lr_pati": 27, "reduceddim": [8, 21], "reduceddimnam": [7, 21], "reduct": [1, 6, 7, 9, 10, 11, 13, 16, 19, 21, 27, 28, 32, 33, 34], "redund": [26, 31], "reem": 2, "ref": [23, 25, 27], "ref_adata_ob": 5, "ref_dir": 23, "ref_emb": 5, "refdata": 27, "refer": [10, 18], "referenc": [21, 23], "reference_cell_typ": 13, "reference_embed": 5, "reference_model": 5, "reference_model_featur": 5, "reference_or_queri": 5, "refin": [5, 6, 7, 13, 23, 26, 30], "refined_pr": 37, "refined_spagcn_domain": 37, "reflect": [1, 4, 5, 6, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 34, 37, 41, 46, 48], "reformul": 51, "refqueri": 27, "refresh": 19, "refseq": 23, "refseq_r80": 26, "refugio": 49, "reg": [12, 26, 38], "reg_mean_plot": 16, "regalado": 49, "regard": [1, 2, 4, 5, 15, 19, 23, 24, 25], "regardless": [14, 15, 21, 48], "regen": 30, "regev": [5, 6, 7, 13, 22, 23, 24, 25, 38, 48, 50], "regex": 25, "regier": [5, 7, 27, 28, 38, 44, 49], "region": [1, 2, 4, 5, 6, 8, 9, 10, 11, 14, 18, 19, 22, 23, 24, 27, 28, 31, 40, 49, 51], "region_clust": 36, "regionstoexclud": 11, "regist": [21, 27], "registri": [7, 36], "regplot": 14, "regress": [5, 7, 13, 15, 17, 33, 36, 41, 51], "regress_out": 41, "regressionmodel": 36, "regul": [2, 8, 9, 14, 15, 16, 18, 25, 26, 50, 51], "regular": [10, 15, 16, 17, 29, 33, 36, 48], "regularli": 19, "regulatori": [5, 9, 11, 15, 19, 24, 27, 30, 50], "regulon": 8, "regulondb": 26, "regulonsauc": 26, "reichart": 7, "reid": [13, 15], "reidenbach": 9, "reimplement": 16, "reinder": [5, 14, 38], "reinforc": 4, "reiniu": 24, "reintegr": 5, "reiss": 2, "rel": [5, 7, 13, 14, 15, 16, 17, 18, 21, 23, 24, 26, 34, 42, 43, 47, 48, 49, 50], "relabel": 37, "relaps": [14, 24], "relat": [1, 2, 3, 4, 5, 6, 8, 11, 13, 15, 18, 23, 24, 26, 33, 38, 40, 49], "related_medication_and_anti": 17, "relationship": [3, 8, 11, 13, 16, 18, 23, 24, 25, 26, 28, 36, 49], "releas": [1, 2, 3, 4, 7, 22, 24, 28, 30], "relev": [1, 2, 4, 5, 7, 8, 11, 15, 16, 17, 19, 23, 25, 26, 28, 29, 32, 45, 48, 49, 51], "relevel": 14, "reli": [2, 3, 4, 5, 7, 13, 15, 17, 21, 22, 23, 24, 25, 30, 36, 38, 49, 50, 51], "reliabl": [14, 18, 21, 23, 30, 37, 51], "relianc": 25, "reliantli": 51, "reload": 11, "reload_ext": 11, "reloc": 1, "remain": [2, 3, 4, 16, 17, 19, 23, 24, 32, 34], "remaind": 5, "remark": [30, 38], "remco": 36, "rememb": [7, 13, 19, 23, 49], "remind": [7, 15, 25], "remit": 14, "remodel": 9, "remot": [21, 23, 25, 27, 28], "remov": [1, 2, 3, 4, 5, 8, 11, 14, 15, 16, 17, 18, 19, 23, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 39, 45, 46, 47, 48, 51], "ren": [9, 14, 24, 37, 39, 41], "renam": [3, 4, 10, 11, 15, 16, 25, 27, 28], "rename_axi": 15, "rename_protein": 27, "renameassai": [27, 28], "renata": 49, "renaud": [6, 17], "renchao": 16, "rene": [7, 48], "rensk": 4, "reorder": [16, 19], "reorder_categori": [13, 19], "reorth": 11, "rep": [3, 14, 17, 26], "rep_idx": 14, "repeat": [1, 6, 11, 14, 15, 16, 27, 28], "repeatedli": 50, "repel": 27, "repertoir": [3, 4, 24, 49], "repertoire_overlap": 1, "repetit": [1, 11], "replac": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "replic": [13, 14, 15, 16, 24, 25], "replicate_color": 14, "replicatepatient_1015": 14, "replicatepatient_1016": 14, "replicatepatient_1039": 14, "replicatepatient_107": 14, "replicatepatient_1244": 14, "replicatepatient_1256": 14, "replicatepatient_1488": 14, "replicates_per_pati": 14, "replogl": [16, 49], "report": [4, 5, 6, 9, 13, 15, 17, 19, 21, 23, 25, 26, 30, 48, 49, 50], "repositori": [3, 30], "repr": 8, "repr_1": 8, "repres": [1, 2, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 18, 19, 23, 25, 28, 32, 33, 34, 36, 37, 40, 46, 49], "represent": [1, 3, 4, 5, 6, 7, 13, 15, 16, 18, 19, 21, 26, 27, 28, 31, 32, 34, 36, 37, 45, 49, 50, 51], "repress": [8, 51], "repressor": 8, "reproduc": [7, 19, 24, 29], "reproduct": 24, "reprogram": 49, "request": [1, 2, 4, 5, 21, 30, 37, 48, 49], "requir": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 43, 44, 45, 47, 48, 49, 50, 51], "rerun": [3, 5, 23, 27, 28, 36], "res_conga": 3, "res_max": 28, "resampl": 13, "research": [0, 3, 4, 5, 7, 9, 14, 15, 18, 23, 24, 25, 30, 31, 36, 38, 49, 50], "resembl": [23, 24, 47, 48], "reserv": 6, "reset": [7, 11, 36, 37], "reset_index": [1, 2, 4, 38], "reset_sourc": 50, "reshap": 27, "reshape2": [7, 21], "reshape2_1": [8, 25, 27, 28], "resid": [5, 13, 48], "resid_expr": 41, "residu": [4, 13, 51], "resin": 24, "resist": 24, "resolut": [5, 6, 7, 13, 16, 17, 18, 19, 24, 25, 33, 36, 37, 38, 43, 49, 50, 51], "resolv": [2, 4, 16, 22, 23, 24, 38, 41, 49, 50], "resort": 45, "resourc": [4, 8, 11, 15, 21, 23, 25, 26, 30, 36, 39, 45, 48], "respect": [0, 2, 3, 6, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 39, 40, 41, 50], "respiratori": [2, 34], "respond": [3, 15, 16, 24], "respons": [1, 2, 3, 4, 7, 13, 15, 18, 21, 24, 25, 30, 38, 49, 51], "ressourc": 3, "rest": [1, 2, 3, 5, 7, 13, 15, 23, 25, 49], "restart": 8, "restfulr_0": 8, "restor": [4, 27], "restrict": [1, 4, 19, 21, 23, 24], "result": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "result_meta": 3, "results_adjac": 26, "retain": [7, 15, 23], "reticul": [7, 21, 25, 27, 28], "reticulate_1": [8, 25, 27, 28], "reticulate_list": 21, "reticulocyt": 12, "retina": 7, "retir": 21, "retkut": 49, "retnlb": 13, "retnlb_express": 13, "retriev": [5, 8, 16, 25, 26, 38, 44, 45, 46, 47, 48], "retrospect": 49, "return": [1, 4, 7, 10, 11, 14, 15, 16, 19, 21, 25, 27, 28, 34, 36, 37, 38, 48, 49], "return_all_lr": 25, "return_info": 15, "returngenelist": 8, "reuben": 16, "reus": [26, 48], "reusabl": 0, "reusch": [17, 26], "reuter": 51, "rev": [8, 25, 30], "rev_comp": 1, "reveal": [2, 3, 5, 6, 7, 13, 15, 16, 17, 23, 24, 30, 32, 33, 34, 38, 40, 42, 48, 49, 50, 51], "revers": [2, 3, 18, 21, 23, 24, 33, 44], "revert": 3, "review": [1, 2, 4, 22], "revolution": 24, "revolutionari": 49, "rey": [19, 22], "reynold": [1, 2, 50], "rez": [5, 26], "reza": 49, "rf4": [5, 12], "rfc3339_valid": 21, "rfc3986_valid": 21, "rfm22": 49, "rfpl1": 8, "rgba": 7, "rgcc": 16, "rgdal": 21, "rge": 50, "rgen": [17, 26], "rgeo": [7, 21], "rgs18": 49, "rhdf5": 21, "rhdf5filter": 21, "rhdf5lib": 21, "rhesu": 1, "rho_": 36, "rhoq": 8, "rhou": 41, "rhpcblasctl_0": 8, "riba": 51, "ribo": 34, "ribonucl": [18, 24], "ribosom": 34, "ricard": [7, 28], "ricardo": [15, 24, 25, 36], "riccardo": 50, "rich": [7, 16, 24, 50], "richard": [5, 13, 23, 24, 37], "richardson": [5, 47, 50], "richoz": 5, "richter": [19, 29, 37, 40, 41], "rick": 23, "rickard": [23, 24], "ridder": 14, "rideout": 49, "rie": 51, "rieck": [7, 11, 27, 28, 34, 48], "rieder": [2, 13, 19], "riek": [17, 26], "riemondi": 5, "riesenfeld": 23, "right": [3, 5, 8, 11, 13, 14, 21, 23, 26, 27, 33, 36, 41, 46, 49, 51], "rigor": [7, 19, 51], "rimorin": 24, "rinterface_lib": [14, 27, 28, 32, 33, 34], "rio": 8, "rise": [2, 11, 49], "risk": [5, 7, 11], "risso": [14, 22, 50], "rita": [40, 51], "ritchi": [14, 15, 23], "riza": [16, 49], "rizvi": 23, "rj": [14, 21], "rjson_0": [8, 25], "rkegren": 15, "rkmd21": 4, "rlang": [7, 21], "rlang_1": [8, 25, 27, 28], "rleifsson": [23, 51], "rlqslqtyv": 4, "rm": 49, "rmarkdown": [8, 21], "rmarkdown_2": 8, "rmpfr": [8, 11], "rmpfr_0": 8, "rn": [23, 24, 51], "rna": [2, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 28, 29, 30, 31, 32, 33, 36, 38, 39, 40, 43, 44, 45, 46, 47, 48, 49, 50], "rna1": 27, "rna1_queri": 27, "rna1_ref": 27, "rna2": 27, "rna2_queri": 27, "rna2_ref": 27, "rna_": 10, "rna_cit": 27, "rna_cite_bridg": 27, "rna_cite_queri": 27, "rna_cite_ref": 27, "rna_count_bas": 38, "rna_count_based_dens": 38, "rna_filtered_feature_bc_matrix": 48, "rna_hidden": 3, "rna_hvg": [27, 28], "rna_hvg_cit": 27, "rna_hvg_multiom": 27, "rna_indices_end": 27, "rna_multiom": 27, "rna_multiome_queri": 27, "rna_num_lay": 3, "rna_raw": 48, "rna_raw_feature_bc_matrix": 48, "rna_snn_r": 17, "rna_var": 27, "rna_veloc": 51, "rnag": 8, "rnamat": 8, "rnapca": 21, "rnapca_1": 21, "rnase": 24, "rnaumap": 21, "rnaumap_1": 21, "rng": 13, "rng_kei": 13, "ro": [32, 33, 34], "roadmap": [25, 49, 51], "roam": 17, "roast": 15, "rob": [23, 25, 51], "robbiani": 2, "robert": [2, 5, 7, 15, 17, 19, 22, 23, 24, 25, 26, 49, 50], "roberto": 1, "robin": [3, 7, 25], "robinson": [6, 11, 13, 14, 32, 33, 34], "robject": [1, 7, 11, 14, 15, 17, 21, 27, 28, 32, 33, 34], "roboto": 8, "robrecht": [7, 11, 27, 28, 34, 48, 50], "robust": [5, 7, 11, 13, 14, 15, 16, 19, 23, 24, 25, 31, 34, 36, 38, 41, 44, 47, 48, 49, 50, 51], "robustli": [2, 23, 36, 50, 51], "robyn": 4, "roch": 24, "rock": 5, "rocm": 5, "rocr": [7, 21], "rocr_1": [25, 27, 28], "roden": [2, 24], "rodriguez": [15, 25, 26, 36, 49], "roe": 23, "rogel": [13, 22], "roger": [5, 14, 19, 24, 27, 28, 48, 50, 51], "rogier": 36, "rogn": 23, "roi": [23, 50], "roja": 5, "rojo": 5, "roland": 40, "role": [1, 16, 17, 18, 25, 49], "romain": [5, 7, 23, 27, 28, 36, 38, 44, 49], "romi": 11, "ronaghi": 24, "ronald": [8, 50], "ronches": 36, "rongbin": 25, "rongxin": 9, "ronquist": 49, "root": [14, 38, 49, 50], "root_ix": 50, "rosa": 7, "rose": 17, "rosebrock": 49, "rosen": [5, 7, 13, 22, 24, 50], "roser": [25, 36, 41], "rosetta2": 23, "ross": [24, 49], "rosshandl": 51, "rotat": [5, 26, 50], "rotatei": 42, "rotation_mod": 26, "rough": [11, 19, 30], "roughli": [13, 14, 16, 36, 40, 41, 48], "round": [7, 11, 13, 16, 18, 23, 27, 28, 34, 48], "roundtoint": 34, "rount": 34, "roussi": 1, "rout": 49, "routin": [6, 13, 15, 25, 34, 49], "row": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 25, 34, 37, 38, 49], "row_attribut": 26, "row_index": 21, "row_linkag": 4, "rowdata": [7, 21, 32], "rowen": 50, "rownam": [7, 8, 10, 14, 15, 21, 25, 27, 28, 34], "rownames_to_column": 25, "rowpair": 21, "rowsum": [8, 17, 34], "royal": [13, 14], "rozenblatt": [5, 7, 13, 22, 24, 50], "rp": 34, "rp1": 38, "rp11": 19, "rpart": 7, "rpart_4": [25, 27], "rpd": 21, "rpkm": 7, "rpl": 34, "rpl13": 41, "rprojroot_2": 8, "rpy2": [1, 7, 11, 13, 14, 15, 17, 21, 25, 27, 28, 31, 32, 33, 34], "rr": 25, "rrna": [13, 18], "rrs1": 41, "rsamtools_2": 8, "rscript": 3, "rsparse_0": 8, "rspectra_0": [8, 27], "rsqlite_2": 8, "rss": [13, 14], "rstatix": 25, "rstudio": [7, 21, 27, 28], "rstudioapi_0": [8, 25], "rsw06": 4, "rt": [18, 24], "rtesi": 7, "rtracklay": 11, "rtracklayer_1": 8, "rtsf": 23, "rtsne": [7, 21], "rtsne_0": [25, 27, 28], "ru": [7, 44], "ruaidhr\u00ed": 13, "ruan": 5, "rubanova": 49, "rubelt": [3, 4], "ruben": [7, 37], "rubric": 23, "rudimentari": [14, 19, 24], "rudolf": [17, 26], "rudolph": 4, "rue": 22, "ruedi": 48, "ruff": 50, "rui": [5, 15, 25, 37], "ruitenberg": 37, "ruizhi": 31, "rule": [11, 13, 19, 23, 24, 26, 49], "ruli": 49, "rumker": 5, "run": [1, 2, 4, 5, 6, 7, 8, 11, 14, 16, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "run_aucel": 15, "run_conga": 3, "run_gsea": 15, "run_harmoni": 44, "run_model_select": 3, "run_nut": 13, "runcgsmodel": 8, "runfigrgrn": 8, "rungenepeakcorr": 8, "runpca": [27, 28], "runspca": 28, "runtim": [1, 3, 11, 14, 38], "runtimewarn": [11, 17, 36], "runumap": [8, 27, 28], "runx2": 26, "ruslan": [50, 51], "russ": 24, "russel": [17, 37, 41, 50], "russkikh": [7, 16], "rust": 23, "rustom": 2, "ruth": [13, 16], "rxra": 8, "ryan": [5, 9, 23, 24, 49], "ryann": 3, "ryazantsev": 7, "rybakov": [5, 19, 37, 40, 41], "ryg": 25, "ryk": 25, "ryr3": [5, 12], "ryu": 17, "ryvkin": [23, 24], "rzw4ugaacaaj": 31, "r\u00b2": 16, "s0016508520353993": 40, "s0092": [17, 26], "s0092867421005833": [5, 27, 28], "s0092867422006511": 5, "s0092867422007838": 5, "s0168": 30, "s0952791513001507": 17, "s1": 7, "s100a11": 15, "s100a9": 5, "s11_aaacctgagattaccc": 3, "s11_aaacctggtaattgga": 3, "s11_aaacctggtagcacga": 3, "s11_aaacctggtctcaaca": 3, "s11_aaacctgtcgccgtga": 3, "s11_aaacctgtcttatctg": 3, "s11_aaacgggcaagaaagg": 3, "s11_aaacggggtagcgatg": 3, "s11_aaacggggtcggcact": 3, "s11_aaacggggttacggag": 3, "s12064": 7, "s12276": 50, "s12859": [13, 14, 23], "s12864": 50, "s12_tttggttgtcagaggt": 3, "s12_tttggtttcaagaagt": 3, "s12_tttggtttctactatc": 3, "s12_tttggtttctcgcttg": 3, "s12_tttgtcacacggtaga": 3, "s12_tttgtcagtagaaagg": [3, 4], "s12_tttgtcagtccaacta": [3, 4], "s12_tttgtcagtgagtgac": [3, 4], "s12_tttgtcatccactcca": [3, 4], "s12_tttgtcatcgcatgat": [3, 4], "s13059": [5, 6, 7, 11, 14, 16, 17, 19, 23, 24, 25, 28, 30, 32, 33, 34, 41, 48, 50, 51], "s13073": 2, "s1672022921000486": 24, "s1d1": [7, 8, 26, 27, 28, 48], "s1d2": [7, 26, 27, 28, 48], "s1d3": [7, 26, 27, 28, 48], "s2001037021000192": 5, "s2001037023000156": 39, "s2405471216303313": 24, "s2405471219302698": 5, "s2405471220304592": 34, "s2452310021000081": 25, "s2667237522000376": 9, "s2_fsv": 41, "s2_logdelta": 41, "s2d1": [7, 26, 27, 48], "s2d4": [7, 26, 27, 48], "s2d5": [7, 26, 48], "s3": [2, 21], "s35": 1, "s3d1": 48, "s3d10": [7, 26], "s3d3": [7, 26], "s3d6": [7, 26, 48], "s3d7": [7, 26, 48], "s41421": 38, "s41467": [5, 9, 13, 14, 16, 17, 24, 25, 31, 41, 47, 51], "s41576": [9, 25, 30, 39], "s41586": [5, 23, 24, 25, 36, 49, 50, 51], "s41587": [5, 7, 13, 16, 17, 23, 24, 27, 36, 48, 50, 51], "s41588": [9, 16], "s41589": 49, "s41591": [5, 7], "s41592": [2, 5, 7, 9, 19, 22, 25, 27, 28, 33, 36, 37, 38, 40, 41, 44, 49, 50, 51], "s41596": [16, 24, 25], "s41598": [5, 6, 23, 25, 50], "s42003": [36, 39, 41], "s43586": 50, "s44": 1, "s4d1": [7, 26, 48], "s4d8": [7, 11, 26, 48], "s4d8_cluster": 5, "s4d8_dimensionality_reduct": 31, "s4d8_feature_select": [31, 32], "s4d8_normal": [32, 33], "s4d8_quality_control": [33, 34], "s4d8_subset_gex": 6, "s4d9": [7, 26, 27, 48], "s4vector": [7, 21], "s4vectors_0": [8, 15, 25, 27, 28], "s_": 38, "s_c": 33, "s_g": 51, "s_score": 51, "sa": 4, "sabrina": [19, 29, 37, 40, 41], "sacrif": 1, "sadekova": 48, "sadi": 49, "saeb": 5, "saec": 2, "saei": [25, 50], "saelen": [25, 50], "saeyslab": 25, "saez": [15, 25, 26, 36], "safe": 24, "safer": 24, "sagar": 24, "sage": 7, "sagenet": 5, "sagiv": 4, "saglam": [17, 26], "sahand": 49, "sai": [7, 8, 11, 15, 17, 21, 23, 26, 38], "said": [1, 5], "saidi": 25, "saiful": [23, 24, 50], "saitou": 49, "sakaguchi": [48, 50], "sake": [13, 19, 25], "saket": 27, "salathia": 15, "salcher": 13, "salgado": 26, "saliba": [14, 17, 26, 50], "salinno": 51, "salmon": 23, "salmon_alevin": 23, "salmon_index": 23, "salmonella": 13, "salomoni": 23, "salom\u00e9": 13, "salvador": 49, "sam": [18, 23, 25, 34, 50], "samakovli": 5, "samantha": [2, 16, 23, 49], "samaran": [7, 38], "samarendra": 14, "samd9l": 25, "same": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 41, 43, 46, 48, 49, 50], "samit": 9, "sampl": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 16, 18, 19, 21, 23, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 39, 41, 44, 45, 46, 49, 50], "sample_col": [13, 25], "sample_color": 14, "sample_condition_ind": 15, "sample_count": 13, "sample_id": [3, 11, 37], "sample_identifi": 13, "sample_kwarg": 36, "sampleid": [17, 49], "samplemap": 21, "samplenam": [7, 27, 28], "samra": 49, "samtool": 23, "samuel": [5, 7, 14, 17, 23, 38, 49], "san": [7, 8], "sanada": 24, "sancho": 25, "sandberg": [23, 24], "sandbox": [7, 11, 27, 28, 34, 48], "sandeep": 4, "sander": [16, 17, 26], "sandrin": [14, 50], "sandu": 2, "sane": [23, 24], "sanger": [5, 24, 38], "saniti": [3, 13], "sanja": 38, "sanjai": 16, "sanjana": 16, "sankaran": [48, 50], "santiago": [15, 23, 49], "santo": 26, "sanz": 2, "sapien": 4, "sapirstein": 49, "sappli": 8, "sar": [2, 3, 4, 7], "sara": [2, 5, 8, 9, 11, 15, 24, 26, 49, 51], "sarada": 24, "sarah": [2, 7, 9, 13, 17, 24, 25, 37, 41, 49, 50], "sarin": 3, "sarita": 36, "sarkar": [23, 37, 51], "sarkin": [36, 50], "sarkozi": 5, "sasagawa": 24, "sascha": [15, 24], "sasha": [14, 15, 16, 25], "satellit": 11, "satija": [5, 7, 9, 14, 15, 16, 19, 23, 24, 27, 28, 47, 48, 50], "satijalab": [16, 27, 28], "satisfactori": 49, "satisfi": [15, 23], "satoko": 5, "satpathi": 3, "sattler": 36, "sauer": [15, 24], "saunder": 16, "save": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "save_d3_html": 8, "save_d3_png": 8, "save_path": 3, "save_path_dir": 11, "saverd": [8, 28], "saw": [5, 7, 9, 10, 21], "sawitzki": [17, 26], "sayan": 15, "sayantan": 23, "sb": 4, "sb19": 2, "sbz": 4, "sc": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "sc_gene": 17, "sc_toolbox": 14, "sca": [5, 14], "scaden": 17, "scaffold": 9, "scalabl": [5, 9, 13, 14, 15, 19, 21, 23, 27, 29, 37, 38, 40, 41, 48, 49, 50], "scale": [1, 2, 4, 5, 6, 7, 8, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 27, 29, 33, 36, 37, 38, 39, 41, 47, 49, 50, 51], "scale_adversarial_loss": 27, "scale_color_gradientn": 8, "scale_color_manu": 8, "scaled_weight": 25, "scaledata": [27, 28], "scales_1": [8, 25, 27, 28], "scales_count": 33, "scalia": 38, "scanorama": 7, "scanpi": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 21, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "scanvi": 7, "scar": 49, "scarch": [5, 27], "scarches_model": 5, "scatac": [7, 8, 9, 10, 11, 22, 48], "scatac_pipelin": 10, "scatac_pp": 11, "scater": 34, "scatter": [1, 7, 8, 11, 13, 16, 23, 34, 36, 37, 46, 49, 50, 51], "scatter_kw": 14, "scattermor": [7, 21], "scattermore_0": [25, 27, 28], "scatterplot": [1, 7, 13, 16, 25, 28, 32, 36, 40, 44], "sccoda": [13, 14], "sccoda_data": 13, "sccoda_model": 13, "sccoda_param": 13, "sccoda_sample_id": 13, "sccolor": 24, "scd": 23, "scdata": 17, "scdatamatrix": 17, "scdbl_result": 11, "scdblfinder": [11, 31, 32, 33, 34], "scdblfinder_class": [31, 34], "scdblfinder_scor": [11, 31, 34], "scdblfinder_scores_": 11, "scdc": [13, 17], "scdecaf": 15, "scdoubletfind": 11, "sce": [8, 11, 21, 32, 34], "sce2anndata": 21, "sce_from_seurat": 21, "sceasi": 21, "sceasy_seurat": 21, "scenario": [7, 8, 13, 16, 19, 26, 27], "scenic": 15, "scenicprotocol": [8, 26], "scetosinglecellassai": 14, "scflow": [19, 29], "scgco": 41, "scgen": 7, "scgestalt": 49, "scglue": [27, 28], "scgluemodel": 27, "scgluetrain": 27, "sch": 14, "schaar": [6, 8, 11, 19, 26, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48], "schalck": 49, "schapiro": 36, "schattgen": 3, "schatz": 1, "schaub": 25, "schechter": 49, "scheibner": 51, "schema_vers": 36, "schemat": 2, "schep": 8, "scherer": 17, "scheuermann": 24, "schiebing": 49, "schier": [7, 49], "schierenberg": 49, "schiller": [5, 7, 50, 51], "schillerlab": 14, "schirg": 51, "schist": 13, "schleiden": 24, "schlesing": 23, "schlickeis": [17, 26], "schmidt": 23, "schmitz": 13, "schnall": [23, 24], "schneider": [7, 11, 17, 25, 26, 27, 28, 34, 36, 48], "schnell": 23, "schnier": [5, 7, 50, 51], "schoettl": 2, "schork": 24, "schrep": [17, 26], "schroeder": [37, 41], "schubert": [3, 13, 15], "schuldt": 2, "schuller": 16, "schult": [17, 26], "schultz": [5, 7, 17, 26, 50], "schulz": [17, 23, 26], "schumach": 36, "schupp": [7, 25], "schurger": 36, "schwann": 24, "schwartz": [17, 23], "sch\u00e4fer": [5, 36], "sch\u00fcbeler": 9, "sci": [17, 23, 26, 43, 49], "sciadv": [17, 25, 51], "scialdon": 14, "scib": [7, 27], "scib_anndata": 28, "scienc": [0, 1, 4, 5, 9, 13, 14, 15, 16, 17, 18, 19, 24, 25, 27, 28, 30, 34, 39, 40, 48, 49, 50, 51], "sciencedirect": [5, 9, 17, 24, 27, 28, 34, 39, 40], "sciencemag": 25, "scientif": [5, 6, 23, 24, 25, 50], "scientist": [24, 30, 49], "scikit": [7, 15, 19, 25], "scipi": [1, 4, 5, 7, 15, 17, 19, 21, 25, 28, 33, 34, 41, 48], "scirpi": [1, 2, 3, 4, 19], "sclerosi": [5, 14], "scnaumi": 24, "scnt": 50, "scope": [3, 4, 19, 25, 30], "score": [3, 4, 5, 6, 7, 8, 13, 14, 16, 17, 18, 23, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 40, 49, 51], "score_col": 14, "score_small_parsimoni": 49, "scott": [4, 5, 7, 11, 13, 15, 17, 23, 27, 28, 34, 48], "scplastic": 49, "scpregan": 16, "scran": [5, 6, 15, 31, 32, 33, 34], "scran_norm": [5, 32, 33], "scratch": 7, "scratchpad": 49, "screen": [4, 25], "screpertoir": [2, 4], "script": [3, 8, 17, 19, 42], "scrna": [2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 26, 27, 31, 32, 33, 34, 36, 38, 44, 47, 48, 49, 50, 51], "scrnaseq": 23, "scroll": 5, "scrublet": 23, "scry": [31, 32, 33, 34], "scseqcomm": 25, "scslam": 50, "sct": 27, "sctransform": [6, 7, 15, 21, 27, 31, 32, 33, 34], "sctransform_0": [25, 27, 28], "scuttl": 21, "scv": 51, "scvelo": 51, "scvers": [2, 5, 13, 16, 18, 19, 21], "scvi": [5, 7, 13, 16, 18, 21, 27, 28, 36, 44, 49], "sd": [13, 23], "sdc3": 38, "se": [1, 8, 23, 41], "seaborn": [1, 4, 5, 7, 11, 13, 14, 15, 25, 26, 28, 32, 33, 34, 38, 44, 48], "sean": [4, 19, 22, 24, 34, 50], "search": [2, 3, 4, 23, 37, 49, 50], "search_l": 37, "search_r": 37, "sebastiaan": 2, "sebastian": [1, 3, 9, 40], "sec": 8, "second": [1, 4, 5, 11, 13, 15, 17, 19, 21, 27, 33, 36, 37, 38, 40], "secondari": [4, 14], "secondli": [34, 47], "secret": [5, 25], "section": [0, 3, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 25, 27, 28, 30, 33, 34, 36, 37, 49], "see": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 41, 44, 45, 46, 47, 48, 49, 50], "seeberg": 23, "seed": [7, 8, 24, 25, 27, 28, 34, 36], "seek": [23, 30, 49], "seem": [5, 11, 13, 14, 16, 25, 33, 36, 38, 40, 41, 49], "seemingli": 0, "seen": [1, 3, 7, 9, 14, 33, 34, 43, 44, 45], "sefik": 13, "segerstolp": 38, "segfault": [7, 21, 27, 28], "segment": [2, 16, 18, 23, 24, 38, 39], "segreg": 23, "sei": 49, "seibold": [5, 7, 50], "seldom": 40, "select": [1, 3, 4, 5, 6, 8, 11, 13, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 29, 31, 33, 34, 36, 38, 40, 41, 45, 47, 48, 50], "select_slid": 36, "select_variance_featur": 16, "selected_cel": 17, "selectintegrationfeatur": 7, "selectmodel": 8, "self": [1, 2, 4, 15, 27], "self_loop_prot": 27, "self_loop_rna": 27, "self_reported_ethn": 36, "sell": 27, "semant": 19, "semi": [7, 17, 23], "semir": [13, 22], "send2trash": [1, 21], "sender_celltyp": 25, "sender_express": 25, "senkamp": [17, 26], "sens": [5, 7, 14, 15, 19, 21, 23, 38], "sensibl": [11, 36], "sensit": [5, 7, 9, 13, 14, 15, 16, 23, 24, 29, 32, 34, 36, 39, 44], "sent": [2, 4, 49], "seo": 23, "seohyon": 34, "seok": 49, "seong": [47, 48], "sep": [2, 4, 5, 10, 14, 16, 17, 25, 26, 34, 47, 48, 49], "sepal": 41, "separ": [1, 2, 3, 5, 7, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 31, 33, 43, 44, 48, 49], "seper": 10, "septemb": [7, 8, 11, 23, 32, 33, 34, 36, 41, 50, 51], "seq": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 30, 31, 32, 33, 34, 36, 37, 38, 39, 44, 47, 48, 49, 50, 51], "seq2": [2, 24], "seq3": 23, "seq_field": 1, "seqeunc": 4, "seqfish": [5, 38, 39], "seqlevelsstyl": 10, "seqlogo_1": 8, "seqnam": 8, "seqs_background": 3, "seqs_elev": 3, "sequenc": [0, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 22, 25, 26, 28, 29, 30, 31, 33, 34, 36, 38, 40, 43, 47, 48, 49, 50, 51], "sequence_align": 1, "sequence_id": 1, "sequencecolumn": 1, "sequenti": [8, 27, 28, 49, 50], "seqv2": 39, "sergei": [5, 19, 37, 40, 41], "serghei": 17, "sergio": [7, 17], "sergushichev": 15, "seri": [1, 13, 14, 17, 23, 26, 47, 49], "serial": 19, "serialis": 21, "serif": 7, "seriou": 24, "serra": 25, "serv": [3, 8, 9, 19, 24, 25, 26, 30, 38, 49], "server": [5, 15], "sesn3": 8, "session": [1, 8, 28, 31, 32, 33, 34], "session_info": [1, 6, 7, 15, 16, 21, 25, 49], "sessioninfo": [7, 8, 15, 21, 25, 27, 28], "set": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "set1": 11, "set_attribut": 49, "set_axi": 7, "set_fdr": 13, "set_figure_param": [1, 5, 6, 15, 16, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 51], "set_index": [5, 11, 15, 25, 28, 36], "set_l": 37, "set_palett": 11, "set_styl": 11, "set_titl": [11, 13, 33, 38], "set_vis": 4, "set_xlabel": [14, 26, 38], "set_xlim": [7, 32], "set_ylabel": [14, 26, 38], "set_ylim": [7, 11, 32], "set_yticklabel": 1, "setclust": 34, "setdiff1d": 49, "seth": 50, "setlevel": [14, 27, 28, 32, 33, 34], "setsoupprofil": 34, "sett": 4, "setti": [50, 51], "settings_embed": 3, "settings_ful": 3, "settingwithcopywarn": [1, 21], "setup": [1, 2, 3, 4, 6, 7, 8, 11, 13, 16, 19, 21, 23, 31, 32, 33, 36, 38, 43], "setup_10x_for_conga": 3, "setup_anndata": [7, 13, 16, 27, 28, 36], "setuptool": [7, 15, 25], "setuptools_scm": [1, 25], "seung": 40, "seurat": [5, 7, 14, 16, 17, 19, 25, 26, 28, 34], "seurat_4": [25, 27, 28], "seurat_clust": [14, 15, 16, 25], "seurat_covid19_freshwb_pbmc_cohort2_incl_raw": 17, "seurat_from_sc": 21, "seurat_h5mu_fil": 21, "seurat_v3": 15, "seuratdisk": 21, "seuratobject": [7, 21], "seuratobject_4": [25, 27, 28], "seven": [16, 24], "sever": [2, 3, 4, 5, 7, 8, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 28, 30, 31, 33, 34, 38, 39, 40, 41, 45, 47, 49, 50, 51], "sex": [2, 5, 11, 17, 36], "sey": 14, "sf": [21, 36], "sfdp": 1, "sforza": 49, "sg": 36, "sgc": 3, "sgener": 8, "sgrna": 16, "sh": 47, "sha": 37, "sha256": 2, "shacknei": 17, "shadow": 42, "shah": [5, 14], "shahrezaei": 24, "shai": 17, "shaina": 24, "shaista": 27, "shalek": [14, 23, 24, 25, 49], "shalini": [3, 4], "shall": 49, "shane": 2, "shankar": 24, "shannon": [19, 22], "shanshan": 49, "shape": [1, 3, 5, 8, 14, 15, 17, 19, 25, 26, 27, 32, 33, 34, 46, 49, 51], "shape_1": [8, 25], "shapovalova": 24, "sharan": 49, "share": [1, 2, 3, 4, 7, 8, 9, 13, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 30, 36, 38, 49, 50, 51], "shared_featur": 36, "shared_hidden": 3, "sharei": 38, "sharma": [3, 4], "shaul": 36, "shaun": [2, 24], "shawn": 49, "shc014": 4, "shea": 7, "sheana": 24, "sheer": 23, "sheet": 23, "shehata": 24, "sheida": 14, "shekhar": [13, 22, 23, 24], "shell": 4, "shelli": [7, 11, 27, 28, 34, 48], "shen": [16, 17, 37], "shendur": [5, 23, 49], "sheng": 24, "shengqi": 39, "shennor": 17, "shepherd": [5, 7, 50], "sheppard": [5, 7, 50], "sheri": [3, 4], "sheridan": 5, "sherman": [38, 49], "sheryl": [7, 11, 27, 28, 34, 48], "shesh": 14, "shi": [5, 7, 13, 14, 15, 22], "shian": 23, "shiau": 9, "shibin": 49, "shifrut": 4, "shift": [1, 3, 4, 7, 13, 16, 18, 25, 31, 34, 36], "shigeki": 49, "shiji": [37, 51], "shila": [7, 51], "shim": 26, "shimon": [48, 50], "shin": [1, 7, 26], "shina": 49, "shini": [7, 21, 23], "shinohara": [37, 41], "shiny_1": [8, 25, 27, 28], "shipe": 37, "shiquan": 41, "shiwei": [5, 14, 16, 19, 27, 28], "shiyi": 34, "shiyu": 4, "shiyuan": 31, "shlomchik": 1, "shm": 49, "shmatko": 36, "short": [2, 4, 18, 23, 24, 25, 40, 49], "shortcom": [21, 24, 38], "shorten": 14, "shorter": [1, 24], "shorthand": 19, "shortli": [19, 37, 39], "shou": [17, 49], "should": [1, 2, 3, 4, 5, 7, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 28, 29, 34, 36, 38, 40, 41, 45, 49, 50, 51], "shoulder": 0, "shouldn": 7, "show": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 48, 49, 50], "show_img": 36, "show_leaf_effect": 13, "show_legend": 13, "show_method": 25, "show_row_dend": 8, "showcas": [2, 3, 4, 5, 9, 10, 11, 25, 26, 27, 28, 34, 38, 39], "shown": [1, 2, 3, 4, 5, 7, 8, 9, 11, 14, 17, 19, 21, 23, 24, 25, 36, 51], "shpak": 15, "shred": 1, "shrubsol": 50, "shrunken": 14, "shruti": 16, "shtokalo": 16, "shu": [7, 39, 49], "shuai": 37, "shuer": 24, "shuffl": [14, 25, 27], "shuga": [23, 24], "shugai": 4, "shun": [48, 50], "shuo": 2, "shuqiang": 24, "shuxiong": 25, "shvet": 43, "shyamal": 13, "sickl": 24, "side": [5, 14, 23, 42, 49], "sidelin": 9, "sieber": 15, "sieghart": 13, "sierra": 23, "sift": 49, "sig": [13, 36], "sign": [2, 5, 14, 15, 16, 25, 27, 50], "sign_thr": 25, "signac": [9, 10], "signal": [1, 2, 5, 7, 9, 15, 16, 18, 23, 24, 26, 27, 28, 34, 36, 38, 41, 43, 48], "signatur": [2, 3, 15, 17, 36], "signedhead": 2, "signific": [7, 11, 13, 14, 15, 16, 17, 23, 25, 30, 41, 47, 48], "significantli": [13, 14, 15, 23, 41], "sijia": 7, "sikand": 36, "sikkema": [5, 7, 50], "silenc": [3, 9], "silhouett": [7, 28, 37], "silhouette_": 28, "silico": [16, 23, 49], "silvia": [49, 51], "sim": [5, 23, 36, 38], "sim_r": 23, "sim_result": 13, "simd": 23, "similar": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 28, 31, 32, 33, 34, 36, 37, 38, 40, 43, 44, 45, 48, 49, 50, 51], "similarli": [2, 3, 4, 5, 13, 14, 16, 19, 23, 25, 34, 43, 49, 50, 51], "simmon": 24, "simon": [2, 5, 6, 14, 15, 16, 19, 22, 23, 24, 25, 40, 49, 50], "simpl": [5, 7, 13, 15, 16, 17, 19, 23, 24, 25, 33, 34, 38, 40, 49, 51], "simple_pca": 19, "simpleaf": 23, "simpleaf_index": 23, "simpleaf_qu": 23, "simplefilt": [1, 2, 3, 5, 13, 16], "simplelist": 21, "simpler": 21, "simplest": [23, 25, 36], "simpli": [3, 5, 13, 15, 16, 17, 19, 23, 33, 34, 36, 37, 45, 47], "simplic": [2, 7, 15, 25, 51], "simplif": [19, 23], "simplifi": [10, 36], "simul": [7, 11, 13, 15, 16, 19, 36, 49], "simultan": [3, 14, 16, 17, 18, 19, 21, 24, 26, 27, 28, 47, 48, 49, 50], "sin": 5, "sina": [23, 51], "sinc": [2, 3, 4, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 27, 28, 34, 36, 37, 40, 41, 45, 47, 48, 49, 51], "sinfo": [1, 25], "singecellexperi": 14, "singer": 49, "singh": [2, 23, 24], "singl": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 18, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 40, 41, 44, 47, 48, 49, 50, 51], "singlecellassai": 14, "singlecellexperi": [7, 11, 14, 15, 21, 27, 28, 33, 34], "singlecellexperiment_1": [8, 15, 27, 28], "singlecellexperimentobject": 21, "singlecellsignalr": 25, "singlet": [11, 34], "singleton": [1, 6, 17], "singular": [7, 11, 16], "sinha": 7, "sini": 14, "sinlg": 2, "sinu": 4, "siong": 7, "sir": [17, 26], "sirna": 18, "sisi": 23, "sister": 49, "sit": [7, 23], "site": [1, 2, 3, 4, 5, 6, 7, 9, 11, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 34, 36, 37, 41, 48, 49, 50], "site2_donor1_cit": 27, "site2_donor1_multiom": 27, "site2_donor4_cit": 27, "site2_donor4_multiom": 27, "site4": [5, 6], "site_color": [27, 28], "situ": [25, 38, 40, 49], "siv": 4, "six": [1, 7, 15, 21, 23, 25], "siyan": 49, "siyuan": 38, "size": [1, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 17, 18, 19, 21, 24, 25, 26, 27, 33, 34, 36, 37, 39, 40, 41, 42, 50, 51], "size_by_donor": 14, "size_factor": [27, 33], "size_factor_kei": 7, "size_of_subtre": 49, "size_pow": 4, "size_rang": 25, "sizefactor": 33, "skaug": 14, "skene": [14, 19, 29], "skeptic": 23, "sketch": 23, "skew": [13, 23], "skewnorm_ufunc": 25, "ski": 7, "skill": 30, "skinnid": [14, 16], "skip": [16, 17, 21, 23, 36], "sklearn": [1, 7, 15, 19, 21, 25, 38, 44], "skmisc": 15, "skum": 14, "slab": 28, "slamf6": 27, "slamf7": 27, "slc16a6": 8, "slc17a7": 41, "slc25a37": [5, 12, 26], "slc2a9": 8, "slc4a1": [5, 12, 26], "slice": [1, 18, 19, 21, 24, 36], "slichter": 14, "slide": [36, 37, 39, 40, 41], "slightli": [1, 3, 5, 7, 13, 43], "slimmer": 28, "slingshot": 50, "sloan": 24, "slot": [7, 11, 16, 19, 21, 28, 51], "slow": [29, 49], "slower": 49, "slowikowski": [7, 44], "slowli": [5, 29], "slug": 50, "slurm": 36, "slyper": [7, 50], "smad7": 8, "small": [0, 1, 2, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 28, 32, 34, 48, 49, 50, 51], "smaller": [2, 5, 13, 15, 16, 23, 24, 34, 36, 37, 39], "smart": [2, 24], "smear": 14, "smet": 24, "smfish": 38, "smibert": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "smilli": [7, 13, 22], "smit": 24, "smita": [7, 11, 13, 16, 27, 28, 34, 48], "smith": [7, 22, 23, 24, 49, 51], "smoker": 2, "smoland": 14, "smooth": [8, 16, 37, 51], "smoothscor": 8, "smoothscoresnn": 8, "smriti": 9, "smudg": 23, "smyth": [14, 15, 19, 22, 37], "sn": [5, 11, 13, 14, 25, 26, 28, 32, 33, 34, 38, 44, 48], "sn87": 49, "snakemak": 21, "snapatac": 9, "snapshot": [13, 24, 50, 51], "sne": [45, 50], "sniffio": [1, 21], "snippet": 8, "snir": 2, "snow_0": 8, "snp": 34, "snr": 18, "snrna": [11, 18, 23, 24, 27, 36, 38], "snyder": 50, "so": [1, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 17, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 36, 39, 41, 46, 48, 49, 50, 51], "societi": [13, 14, 49], "sock": 21, "socorro": 26, "socs1": [14, 25], "soen": 51, "soeren": 7, "sofi": 2, "soft": 23, "soften": 51, "softwar": [2, 7, 9, 11, 19, 23, 26, 34, 49], "soh": 49, "sohrab": [5, 14], "soichiro": 49, "sok58": 49, "sokal": 49, "sola": 23, "solana": [6, 50], "solar_extra": 8, "soldatov": [50, 51], "sole": [16, 19, 48], "solexa": 24, "solid": [16, 24, 30], "sollid": 2, "solo": 23, "solomon": 49, "solongo": [23, 24], "solubl": 2, "solut": [2, 9, 11, 13, 14, 15, 22, 23, 24, 34], "solv": [13, 17, 18, 36, 49], "solver": 49, "somaraki": 14, "somat": [1, 2, 4, 49], "some": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 46, 49, 50, 51], "someth": 7, "sometim": [5, 7, 11, 21, 23, 24, 34, 50], "somewhat": 23, "somewher": 7, "son": 24, "sonal": 9, "sonali": 23, "soneson": [6, 14, 22, 23, 51], "song": [15, 26], "sonia": 49, "sonja": 15, "sonrel": [32, 33, 34], "sontak": 5, "soomin": 49, "soon": [9, 29], "sophi": 51, "sophia": [15, 17, 26], "sophist": [16, 23, 45, 49], "sopper": 13, "soraya": 24, "sorcha": 50, "soroor": [14, 15], "sort": [2, 3, 4, 8, 13, 14, 15, 16, 17, 23, 24, 32, 41, 44], "sort_ord": 5, "sort_valu": [5, 14, 15, 16, 17, 25, 26, 41, 49, 51], "soufian": 38, "soumya": [5, 7, 44], "sound": [11, 13, 21, 29], "sountoulidi": 7, "soup": 34, "soupchannel": 34, "soupprof": 34, "soupx": [23, 31, 32, 33, 34], "soupx_count": 34, "soupx_group": 34, "souquett": [3, 4], "sourc": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 28, 30, 36, 49, 50], "source_label": 25, "sources_loc": 50, "sox17": 38, "sox6": 26, "sp": [4, 7, 21], "sp_1": [25, 27, 28], "space": [1, 2, 3, 5, 6, 7, 13, 14, 16, 17, 18, 19, 23, 27, 28, 29, 31, 34, 36, 37, 40, 41, 43, 49, 50], "spagcn": [36, 38, 40, 41], "spagcn_domain": 37, "spage": 38, "spain": 42, "span": [2, 13, 16, 23, 31, 50], "spanjaard": [7, 49], "spark": 41, "spars": [1, 3, 4, 5, 7, 9, 11, 13, 15, 18, 19, 21, 24, 26, 28, 31, 33, 34, 38, 43, 47, 48, 49, 51], "sparse_3": [25, 27, 28], "sparsematrix": [8, 34], "sparsematrixstats_1": 8, "sparsiti": [5, 11, 38], "sparsity_diff": 38, "sparsity_sc": 38, "sparsity_sp": 38, "spata2l": 41, "spatial": [4, 7, 13, 18, 19, 21, 22, 24, 25, 30], "spatial_autocorr": 41, "spatial_connect": [37, 40, 41], "spatial_dist": [37, 40, 41], "spatial_neighbor": [37, 40, 41], "spatial_scatt": [36, 37, 41], "spatialaba": 36, "spatialal21": 41, "spatialammr20": 38, "spatialbsb": 38, "spatialclc": 37, "spatialcmz": 36, "spatiald": [36, 37, 38, 40], "spatialde2": 41, "spatialdwl": 36, "spatialdzd": 37, "spatialebnm": 36, "spatialfdr": 13, "spatialgfgd10": 40, "spatialhlc": [37, 41], "spatialkrfl": 36, "spatialksd": 36, "spatialkvts21": 41, "spatiallli": 38, "spatialllk": 36, "spatiallnl": 38, "spatiallzg": [36, 38], "spatialmlh22": 39, "spatialpsk": [37, 40, 41], "spatialptx": 37, "spatialsts18": 41, "spatialszz20": 41, "spatialthd": 40, "spatialwcr": [39, 41], "spatialylh": 39, "spatialzfw22": 41, "spatialzsr": 37, "spatialzsz21": 41, "spatiotempor": 37, "spatstat": [7, 21, 25, 27, 28], "spbks22": 48, "spca": [27, 28], "speak": [24, 30, 51], "spec": 7, "spec_weight": 25, "speci": [1, 4, 7, 15, 23, 26, 34, 49], "special": [2, 17, 18, 19, 21, 23, 24, 25, 49], "species_align": 4, "species_fullir": 4, "species_manu": 4, "species_vj": 4, "specif": [1, 2, 3, 5, 6, 7, 8, 9, 10, 11, 13, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 28, 30, 31, 32, 34, 38, 41, 43, 46, 47, 48, 49, 50, 51], "specifi": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "specificity_rank": 25, "specimen": 38, "spectratyp": 3, "spectrometri": 29, "spectrum": 13, "speed": [3, 5, 11, 14, 16, 23, 24], "spenc": 5, "spg": 37, "sphinxcontrib": 7, "spieckermann": 40, "spielmann": 23, "spike": [18, 23, 24, 28], "spindl": 24, "spitz": 8, "spitzer": [19, 37, 40, 41], "spkmf": 44, "splba16": 48, "splbc": 48, "splic": 23, "splice": [2, 18, 21, 24, 50, 51], "splici": 23, "splici_ref": 23, "splici_rl90_ref": 23, "splines_4": [8, 25, 27, 28], "split": [7, 10, 13, 14, 15, 19, 23, 27, 28, 38, 40, 44, 48, 49], "split_assay_nam": 10, "split_bi": 16, "splitobject": 7, "splrc": 44, "spmlc": 48, "spoken": 39, "spon2": 12, "spot": [13, 15, 36, 37, 38, 39, 40], "spot_siz": 38, "spotlight": 36, "sppzk": 48, "spread": [15, 19, 36, 37], "springer": [4, 15], "springer2021contribut": 4, "sprwyfyyl": 4, "spsbeo": 48, "spsh": 48, "spuriou": 23, "spxd22": 48, "spyro": 24, "spzjt": 48, "sq": [36, 37, 40, 41], "sqe": 9, "squair": [14, 16], "squar": [4, 14, 50], "squareform": 4, "squidpi": [5, 19, 36, 38, 40], "squidpy_domain": 37, "squish": 8, "srb": [1, 2], "src": 10, "srcb": 24, "srivastava": [5, 9, 14, 19, 23, 27, 28, 51], "srivatsan": 16, "srollah": 14, "srun": 36, "ssbp2": [5, 12], "ssf": 2, "ssgsea": 15, "sspn": [5, 12], "sst": 49, "sswt83": 49, "st": [24, 36], "stab2": 38, "stabil": [2, 15, 31, 33, 34, 41], "stabl": [1, 5, 6, 15, 18, 19, 21, 49, 50], "staci": 49, "stack": [1, 13, 19, 27, 48], "stack_data": [7, 15, 21, 25], "stackedbarplot": 1, "stadler": 23, "stage": [3, 5, 6, 7, 9, 21, 23, 24, 48, 49, 50], "stai": [15, 27, 30], "stamataki": 14, "stamp": 24, "stanca": 1, "stand": 23, "standard": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 17, 21, 23, 25, 26, 28, 29, 30, 32, 33, 36], "standard_scal": [5, 26], "stanfield": 4, "stanislav": 23, "stanlei": [13, 17], "star": [23, 34], "stark": 13, "starsolo": 23, "start": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 16, 17, 18, 19, 21, 23, 25, 26, 28, 29, 31, 32, 34, 36, 37, 40, 43, 47, 48, 49, 50], "startswith": [34, 36, 37, 49], "startup": [27, 28], "stat": [4, 7, 8, 14, 15, 17, 25, 27, 28, 34, 36, 48], "stat1": [15, 16], "state": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 24, 25, 26, 30, 34, 36, 37, 40, 49, 50], "state_to_indel": 49, "statement": 30, "static": [4, 23, 49, 50], "staticmethod": 28, "station": 2, "stationari": [2, 24], "statist": [3, 5, 6, 7, 13, 14, 15, 16, 21, 23, 25, 28, 29, 30, 33, 34, 36, 40, 41, 50], "statmod": [13, 15], "statmod_1": 15, "stats4": [8, 15, 27, 28], "stats4_4": 25, "statsmodel": [1, 7, 15, 19, 25], "statu": [1, 2, 7, 13, 17, 21, 23, 49], "status": 1, "status_df": 17, "status_on_day_collect": 2, "status_on_day_collection_summari": 2, "std": [21, 44], "stddev": 17, "stdout": 23, "stds_per_cluster_mu_fg": 36, "steadi": [18, 25], "steady_rank": 25, "steelman": [7, 11, 27, 28, 34, 48], "steemer": 23, "steen": 17, "steer": 38, "stefan": [2, 3, 13, 17, 23, 26, 49, 50, 51], "stefani": [23, 24, 49], "steffen": 51, "stegemann": [17, 26], "stegl": [7, 14, 15, 19, 24, 28, 36, 41, 48], "stegui": 5, "steidl": 5, "steier": [27, 28], "steiger": 40, "stein": [8, 9, 26, 51], "steiner": [17, 49], "stem": [1, 2, 3, 4, 5, 13, 24, 28, 38, 49, 50, 51], "sten": [23, 24, 50, 51], "step": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "stepanek": 43, "stephan": [14, 17, 23, 26], "stephani": [5, 14, 16, 19, 22, 23, 27, 28, 32], "stephen": [24, 26, 37], "stephenson": [1, 2, 16, 47, 48, 50], "ster": 14, "stereo": 39, "stern": 1, "sterr": [7, 11, 27, 28, 34, 48], "steven": [1, 2, 4, 7, 23, 24, 43, 50], "stg": 36, "stick": [2, 4, 11], "stijn": [7, 25], "still": [2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 16, 17, 19, 21, 23, 24, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 43, 44, 48, 49, 51], "stim": [14, 16, 25], "stim_fcgr3a": 15, "stim_kei": 16, "stimul": [1, 2, 3, 14, 25], "stimulated_b": 15, "stimulated_cd14": 15, "stimulated_cd8": 15, "stimulaton": 16, "stimuli": [1, 16, 24, 25, 51], "stimulu": 15, "stitzel": 11, "stl21": 4, "stlearn": 37, "stler": 51, "stmn1": 12, "stochast": [13, 18, 31, 49], "stoeckiu": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "stone": [37, 50], "stop": [2, 5, 16, 18, 27, 28, 36, 37], "stopifnot": 8, "storag": [17, 18, 19, 21], "store": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 28, 32, 34, 36, 37, 38, 40, 41, 45, 49, 50, 51], "storemag": 1, "str": [1, 2, 3, 4, 7, 13, 15, 17, 25, 26, 27, 34, 42, 43, 46, 48, 49], "str_split": 10, "straightforward": [1, 11, 14, 23, 36, 37], "strain": 15, "strand": [18, 23, 24], "stranger": 17, "strategi": [9, 14, 17, 23, 24, 30, 31, 34, 37, 49, 50, 51], "stream": [2, 26, 37, 49, 51], "street": [7, 27, 28, 50, 51], "strength": [3, 4, 13, 19, 21, 24, 25, 36], "strengthen": 5, "streptavidin": [2, 48], "stress": [7, 14, 24], "strict": [2, 13, 49], "strictconverg": 14, "stricter": 4, "strictli": 30, "strike": 16, "string": [1, 2, 3, 7, 15, 18, 19, 23, 34, 49], "stringent": [4, 16, 17, 48], "stringi": [7, 21], "stringi_1": [8, 25, 27, 28], "stringr": [7, 10, 21], "stringr_1": [8, 25, 27, 28], "strip": [15, 23, 26], "stripe": 23, "strive": 30, "strn3": 8, "strobl": [5, 7, 27, 28, 43, 44, 45, 46, 47, 48, 50], "stroke": 24, "strong": [1, 7, 8, 13, 16, 17, 18, 19, 21, 22, 24, 40, 42, 49], "stronger": [13, 16, 49], "strongest": 7, "strongli": [1, 8, 13, 14, 19, 24, 26, 34], "strsplit": 8, "structur": [2, 3, 4, 5, 6, 7, 8, 9, 15, 17, 18, 19, 21, 23, 24, 25, 28, 31, 33, 39, 40, 41, 49], "struggl": 13, "strunz": [3, 7], "stuart": [5, 7, 9, 14, 19, 27, 28], "stubbington": [2, 3], "student": [0, 14, 17, 31], "studi": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 17, 18, 19, 22, 23, 24, 26, 31, 41, 44, 45, 47, 48, 49, 50, 51], "study_id": 2, "study_nam": 3, "stuff": 30, "sturm": [2, 13, 19, 25], "style": [7, 13, 16, 26, 42], "su": [5, 15, 23], "suastegui": [7, 50], "sub": [3, 5, 6, 11, 17, 23, 26, 32, 34, 49], "subchapt": [14, 34], "subclon": 49, "subclust": 3, "subcort": 24, "subdivid": 5, "subfield": 30, "subgraph": 4, "subgroup": 17, "subject": [5, 7, 13, 14, 15, 19, 22, 23], "subject_id": 19, "subobject": 48, "subplot": [5, 7, 11, 13, 14, 25, 26, 33, 38], "subpopul": [7, 13, 14, 16, 34, 49], "subproblem": 49, "subramaniam": [14, 15, 16, 25], "subramanian": [7, 15, 38, 49], "subsampl": [3, 5, 13, 16, 34], "subsample_s": 16, "subsampled_summ": 15, "subsect": [3, 24], "subsequ": [5, 6, 11, 13, 18, 23, 24, 25, 31, 32, 33, 34, 36, 41, 48, 49], "subset": [1, 3, 4, 5, 7, 8, 13, 14, 15, 16, 17, 18, 21, 23, 26, 27, 28, 32, 36, 38, 41, 49, 51], "subset_nhood": 13, "subset_sampl": 13, "subsetcormus": 17, "subspot": 37, "substanti": [13, 15, 22, 23, 36], "substat": 6, "substitut": [1, 4, 18, 23, 24], "substr": 23, "substructur": [6, 49], "subtask": 7, "subtl": [7, 13], "subtract": [4, 16], "subtyp": [2, 4, 5], "subunit": 25, "success": [7, 15, 16, 17, 18, 21, 29, 36, 39, 48, 49, 50], "successfulli": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "successor": 24, "suchanek": 5, "sudberi": [23, 51], "suddenli": [16, 24], "suffer": [17, 24, 29, 31], "suffic": [7, 30], "suffici": [3, 4, 11, 13, 14, 23, 24, 25, 34, 51], "suffix": [4, 27, 43], "suggest": [1, 3, 7, 9, 11, 15, 16, 17, 21, 23, 25, 26, 30, 44, 49, 51], "suguna": 24, "suit": [1, 3, 4, 15, 16, 22, 33, 34, 37, 49], "suitabl": [1, 11, 13, 16, 17, 23, 24, 31, 37], "suiter": 49, "sukhov": 15, "sullivan": [7, 24], "sulston": 49, "sum": [4, 5, 13, 14, 15, 17, 19, 21, 23, 25, 26, 27, 33, 34, 36, 38, 40, 41], "sum_": [36, 38], "sum_g": 33, "sum_i": 38, "sum_j": 38, "sumeer": 7, "summar": [3, 8, 11, 15, 19, 23, 26, 49], "summari": [3, 7, 13, 14, 23, 28, 30, 36, 40, 49], "summaris": 36, "summarize_tumor_qu": 49, "summarizedexperi": [7, 8, 19, 21], "summarizedexperiment_1": [8, 15, 27, 28], "summarizedexperimentobject": 8, "summary_metr": 16, "summarycond": 14, "summarydt": 14, "summat": 36, "sumner": 17, "sun": [5, 7, 25, 41, 48, 49, 50], "sundstr": [50, 51], "sung": 36, "sungnak": [1, 2], "sunil": [7, 11, 27, 28, 34, 48], "sunkin": 24, "sunmo": 26, "sunphil": 26, "suo": 50, "suoqin": 25, "superior": 14, "supervis": [3, 5, 7, 17, 23, 28], "supplement": 30, "supplement_2": 16, "supplementari": 36, "suppli": [7, 8, 11, 15], "support": [1, 2, 3, 5, 10, 11, 15, 18, 19, 21, 23, 24, 25, 26, 29, 30, 48, 49], "suppos": [23, 36], "suppress": [3, 16], "suppressmessag": 8, "suppresspackagestartupmessag": [11, 15, 25, 27, 28], "suppresswarn": 11, "suptitl": [4, 11], "sur": 15, "surani": 25, "sure": [5, 7, 10, 11, 13, 21, 23, 27, 28, 49], "surfac": [2, 16, 18, 19, 24, 28, 43, 44, 45, 46, 47, 48], "surpass": 3, "surpris": [2, 7, 24], "surround": [2, 5, 19, 23], "survei": [7, 13, 14, 22, 24], "surviv": [7, 21, 24], "survival_3": [8, 25, 27, 28], "susan": [24, 25, 49], "susann": [7, 36], "suscept": 15, "susi": 26, "susmelj": 16, "suspens": [2, 9, 24], "sustain": 18, "suttorp": [17, 26], "suzuki": 23, "su\u00e1stegui": [43, 44, 45, 46, 47, 48], "svd": [7, 11], "svd_solver": [19, 27, 31, 45], "svddc": 16, "svejnoha": 4, "svensson": [7, 24, 41], "svetlana": 48, "svg": [1, 3, 41], "svg_logo": [1, 3], "svgwrite": 1, "svoboda": 24, "swab_result": 2, "swain": 17, "swami": 7, "swanton": 49, "swap70": 8, "swap_ax": 14, "swapnil": 4, "swarbrick": 24, "swat": 5, "swati": [23, 24], "swell": 24, "swerdlow": [16, 47, 48, 50], "switch": [2, 4, 19], "sy": [3, 14, 15], "sycheva": 4, "sykora": 13, "sylvi": [5, 7], "sylvia": 36, "sym": 1, "symbol": [15, 17, 23, 26, 49], "symmetri": [4, 27], "symphoni": 5, "symposium": 50, "syndrom": [2, 50], "syne1": [5, 12], "syngr1": [5, 12], "synonym": [1, 49], "syntax": 13, "synthes": [18, 24], "synthesi": [18, 23, 24, 48], "synthet": [4, 18, 49], "system": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "systemat": [5, 6, 17, 24, 25, 49], "szabo": [2, 5, 19], "szafer": 24, "szalai": 25, "szczurek": 14, "szymon": 14, "s\u00f6ren": 40, "t": [1, 2, 3, 4, 5, 7, 8, 11, 12, 13, 14, 15, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 41, 43, 44, 45, 46, 47, 48, 49, 50], "t23": 25, "t2g_3col": 23, "t6": 4, "t_stat": 15, "ta": 13, "taacttcagatacagt": 27, "taatt": 49, "tab": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "tab10": 11, "tab20c": 1, "tabaka": [49, 50], "tabib": [5, 7, 50], "tabix": 11, "tabl": [1, 2, 5, 7, 8, 11, 14, 15, 16, 21, 23, 24, 25, 26, 28, 34, 41, 45, 49], "table_1": [8, 25, 27, 28], "tacacgatcgggagta": 3, "tacaggtgttagagta": [27, 28], "tack": 25, "tackl": [13, 14, 16, 33, 36], "tadataka": 25, "tae": [1, 24], "taejeong": 49, "tag": [2, 3, 4, 11, 14, 16, 18, 23, 24, 27, 28, 34, 48], "tagment": [9, 24], "tagtggtagcgattct": 3, "tagwis": 14, "taha": [14, 16], "tail": [11, 23, 24, 26], "tailor": [22, 25, 47, 49], "taipal": 24, "tak": 26, "take": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 24, 25, 26, 27, 28, 34, 36, 37, 38, 40, 41, 47, 48, 49, 51], "takeawai": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51], "taken": [1, 4, 7, 9, 13, 16, 19, 23, 50, 51], "takeshima": [48, 50], "tal": [4, 7, 9, 15, 17, 26, 28], "talaga": 24, "talavera": [5, 7, 50], "talk": [5, 21], "tallapragada": 24, "tallulah": 23, "tama": [2, 19], "tamara": [1, 24], "tamayo": 15, "tamili": 49, "tamim": [5, 38], "tamsyn": 47, "tan": [7, 15, 25, 37], "tanaka": [24, 49], "tandem": 49, "tanenbaum": 50, "tanevski": [15, 36], "tang": [2, 36, 38, 49], "tangram": [36, 37, 40, 41], "tangram_ct_pr": 38, "tansu": 9, "tantivit": 7, "tanya": 24, "tao": [3, 15, 25, 49], "tapsi": 49, "tar": [23, 49], "targ": [14, 15, 16, 25], "target": [1, 2, 3, 4, 7, 8, 13, 15, 16, 17, 18, 23, 24, 26, 33, 34, 38, 39, 48, 49], "target_col": [1, 2, 3], "target_gen": 16, "target_gene_id": 16, "target_label": 25, "target_num": 37, "target_sum": [5, 14, 25, 33], "tarjei": [23, 24], "tarqui": 51, "tasccoda": [13, 14], "tasccoda_data": 13, "tasccoda_model": 13, "tasic": 24, "task": [3, 7, 16, 17, 18, 23, 25, 26, 27, 28, 29, 30, 31, 33, 34, 36, 37, 38, 40, 41, 49], "tata": [5, 7, 50], "tatcaggagtgaacat": 3, "tatch": [7, 28], "tatgattagtcgcg": 49, "tatgattagtcgcgr1": 49, "tatgattagtcgcgr2": 49, "tatsuya": [48, 50], "tau": 15, "tauber": [17, 26], "taught": 30, "taylor": [1, 5, 7, 24, 25, 37, 40, 50], "tb01195": 13, "tb02031": 14, "tbb": 13, "tbi": 19, "tbl": 26, "tbrd2": 1, "tcacaaggtggtgtag": 3, "tcacctggttaggttg": 7, "tcaggcgatgcgaa": 49, "tccgaaaaggatcata": [27, 28], "tcf25": 41, "tcf4": [5, 12], "tcf7": [5, 12], "tcf7l2": [5, 12, 26], "tcgaagtgtgacaggt": 27, "tcgggaccagcatgag": 3, "tcm": 5, "tcr": [2, 19, 27, 43], "tcr_00_gex": 3, "tcr_00_read_align": [2, 3], "tcr_01_preprocess": [2, 3, 4], "tcr_clump": 3, "tcr_embed": 3, "tcr_filter": 1, "tcr_mergedupd": 2, "tcrb18": 1, "tcrdist": 3, "tcrdist3": 1, "tcrmatch_input": 4, "tcrmatch_output": 4, "tcrrep": 4, "tcrva7": 12, "tcrvd2": 12, "tcr\u03b2": 4, "tcttcctagccaaccc": 27, "teach": [22, 30], "team": [2, 5, 19], "tec": 8, "tech": 3, "technic": [5, 7, 9, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 32, 33, 36, 38, 43, 47, 48, 49], "technician": 23, "techniqu": [0, 3, 7, 8, 22, 23, 27, 31, 32, 33, 34, 41, 49, 50, 51], "technolog": [49, 50], "technologi": [3, 5, 7, 16, 17, 19, 21, 24, 27, 28, 31, 34, 36, 37, 39, 40, 50], "tedsim": 49, "teemu": 24, "teichmann": [2, 5, 7, 13, 24, 25, 41, 50], "tek": 38, "tel": 5, "tell": [1, 5, 7, 24], "tem": 5, "temesgen": 7, "temp": [25, 45, 46], "temp_dir": 21, "tempfil": 21, "templat": [2, 18, 24, 33], "tempor": [25, 49, 50], "temporari": [2, 5, 16], "temporarili": 11, "temporarydirectori": 21, "tempt": 7, "temra": 5, "ten": [1, 3, 8, 13, 24, 40, 48], "tend": [7, 11, 15, 17, 21, 23, 25, 49], "tendenc": 23, "tenenbaum": [19, 22], "teng": 14, "tensor": [7, 21, 25, 38], "tensor_1": [25, 27, 28], "tensorboard": 7, "tensorflow": 5, "terentyev": 16, "term": [1, 5, 6, 7, 8, 14, 15, 16, 19, 22, 23, 24, 26, 29, 31, 32, 33, 34, 36, 37, 38, 39, 41, 49, 51], "termin": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "terminado": 1, "terri": [23, 24], "terril": 48, "tessa": [5, 7, 50], "tessa_clust": 3, "tessa_cluster_top10": 3, "tessa_embed": 3, "tessa_fin": 3, "tessa_gex": 3, "tessa_log": 3, "tessa_main": 3, "tessa_ob": 3, "tessa_tcr": 3, "tessa_tcr_embed": 3, "test": [1, 3, 4, 5, 7, 8, 11, 14, 16, 17, 19, 23, 25, 28, 33, 36, 38, 40, 41, 49], "test_haniffa": 3, "test_ligand": 25, "test_overestim_var": 3, "test_sampl": 13, "test_var": 13, "testig": 14, "tether": 24, "tetram": 4, "tetsutaro": 24, "text": [2, 4, 18, 21, 26, 36, 38, 42], "text2vec_0": 8, "text_color": 42, "text_html": 42, "textbf": 38, "textcoord": 7, "texttabl": [1, 7], "tf": [8, 9, 15, 27, 28], "tf_cpp_min_log_level": [5, 27, 28, 36], "tf_name": [8, 26], "tfbstools_1": 8, "tfmpvalue_0": 8, "tfmr_dropout": 3, "tfmr_embedding_s": 3, "tfmr_encoding_lay": 3, "tfmr_num_head": 3, "tfrc": [5, 12, 27, 38], "tfrt_cpu_0": 16, "tfs_path": 26, "tg": [36, 38], "tgacagtcatggctgc": 28, "tgagactcaatagtag": 28, "tgatataaatctttr2": 49, "tgcgaaagcgggcgggctacgattactatgatagtagtgactgacc": 2, "tgcgcagtctcaagtg": 3, "tgcggaacatgggatagcagcctgagtgcttgggtgttc": 2, "tgctcgtgttcgaagg": 23, "tgf": 16, "tggcc": 49, "tggtt": 49, "tggttttaat": 49, "tgtgaaggtcaata": 49, "tgtgcagcatgggatgacagcctgagtgcctcttatgtcttc": 2, "tgtgcgaaagcttggatcggactcgactccgagatttattatgatt": 2, "tgtgcgaaccccacccgtccatatagcagcagctggtggtactttg": 2, "tgtgcgagagacaaccgagtctattacgatttttggagtggttatc": 2, "tgtgcgagagatcgtcgttcagcttattgtagtggtggtagctgct": 2, "tgtttttgtctgca": 49, "tgtttttgtctgcar1": 49, "th": 13, "thakor": [16, 48, 50], "thakurta": 24, "thalamu": 41, "thamar": 14, "than": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 33, 34, 36, 37, 38, 39, 44, 46, 49], "thank": 7, "thankfulli": 21, "thap3": 3, "tharp": 2, "thei": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 44, 48, 49, 50, 51], "theislab": [2, 27, 28, 30, 50], "them": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 16, 19, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 36, 37, 43, 45, 46, 48, 50, 51], "theme": 8, "theme_class": 8, "theme_cowplot": 8, "theme_grai": 8, "theme_set": 8, "themi": 8, "themselv": [16, 19, 22, 23, 24, 25, 36, 38, 50], "theodor": [5, 7, 17, 24, 26, 50], "theodoro": 7, "theorem": 26, "theoret": [0, 3, 23, 33], "theori": [4, 6, 7, 13, 24, 31, 50], "therapeut": [4, 17, 24], "therapi": [2, 16], "therebi": [2, 3, 4, 5, 15, 24, 50], "therefor": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 36, 38, 40, 41, 44, 45, 48], "therein": 51, "theresa": 49, "thermoplast": 2, "theta": 23, "thgen": 15, "thi": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "thibeault": [17, 26], "thibodeau": 11, "thicker": 1, "thickest": 1, "thielert": 29, "thieri": 37, "thierri": [1, 30], "thin": [2, 24], "thing": [5, 7, 19, 48], "think": [1, 25, 30], "third": [4, 5, 7, 17, 33, 36, 38], "thirti": [7, 11, 27, 28, 34, 48], "thoma": [1, 3, 5, 7, 13, 14, 15, 16, 17, 19, 22, 23, 26, 37, 47, 49, 50], "thomson": [23, 49], "thorvaldsd": 15, "those": [1, 2, 5, 7, 8, 9, 14, 15, 19, 21, 23, 24, 25, 26, 27, 30, 34, 38, 39, 46, 48, 49], "though": [2, 7, 13, 15, 19, 23, 24, 27, 28, 29, 49, 50, 51], "thought": [5, 11, 25, 30], "thousand": [5, 13, 14, 16, 17, 24, 28], "thp": 16, "thread": [13, 23], "threadpoolctl": [1, 7, 15, 21, 25], "three": [1, 2, 3, 4, 5, 7, 9, 10, 13, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 31, 33, 34, 37, 39, 41, 49, 51], "threshold": [1, 3, 4, 5, 13, 19, 23, 25, 26, 34, 36, 37, 46, 48, 49, 50], "through": [1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 29, 30, 31, 34, 36, 37, 39, 40, 41, 45, 48, 49, 50, 51], "throughout": [2, 5, 9, 13, 19, 23, 34, 36, 49], "throughput": [1, 2, 4, 9, 13, 16, 18, 19, 22, 23, 24, 26, 31, 38, 49], "thu": [5, 7, 14, 15, 16, 23, 25, 26, 36, 44, 45, 47, 48, 49, 50, 51], "thuc": 24, "thumb": [11, 13, 26, 49], "thurman": 14, "thymocyt": 5, "thymu": 2, "ti": [23, 50, 51], "tian": [5, 6, 23, 24, 36, 38, 47, 48, 49], "tianqi": 24, "tianxiao": 37, "tianyu": [14, 25], "tianyuan": 25, "tibbl": [7, 21, 25], "tibble_3": [8, 25, 27, 28], "tick": 23, "tick_param": 5, "tickl": 50, "tickotski": 4, "tidi": 7, "tidyr": [7, 21, 25], "tidyr_1": [8, 25, 27, 28], "tidyselect": [7, 21], "tidyselect_1": [8, 25, 27, 28], "tierrafr": 26, "tiesmey": 40, "tieu": 24, "tif": 37, "tiff_0": 8, "tig": 30, "tight": 15, "tight_layout": [4, 11, 13, 26, 38], "tigit": [12, 45], "tild": 36, "tile": 23, "tiledb": 21, "tilgner": 24, "tillag": 1, "tim": [5, 7, 9, 14, 19, 27, 28], "time": [0, 1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 34, 38, 41, 50, 51], "time_after_lp": 2, "time_yr": 19, "timechange_0": 25, "timedate_4022": 25, "timen": 5, "timeout": 25, "timepoint": [13, 36, 51], "timo": [24, 40], "timothi": [24, 50], "timp1": 25, "ting": [5, 25, 49], "tini": 24, "tip": [13, 49], "tirosh": [13, 22, 23, 24, 49], "tissu": [2, 5, 7, 9, 13, 15, 16, 17, 24, 25, 32, 37, 39, 40, 41, 49, 50, 51], "tit": 50, "titl": [3, 11, 13, 14, 16, 17, 22, 36, 49], "tl": [1, 2, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 43, 44, 45, 49, 50, 51], "tle1": 8, "tlz": 1, "tm": 4, "tm9sf2": 8, "tmem140": 25, "tmlhe": 7, "tmm": 13, "tmp": [3, 4, 5, 27, 28], "tmpihngzax_": 5, "tmsb4x": 14, "tn5": 9, "tnf": 12, "tnfrsf13c": 27, "tnfrsf25": 7, "tnfrsf9": 27, "tnfsf10": [15, 25], "tnrc6b": 8, "to_adata": 5, "to_csv": [2, 3, 4, 11, 14, 36], "to_df": [15, 19], "to_list": 1, "to_numpi": [15, 17], "toarrai": [5, 13, 19, 36, 37], "tobia": [14, 17, 23, 24, 26, 50], "tocoo": 33, "tocsc": 33, "todai": [0, 17, 24], "todd": 15, "todens": 3, "todo": [2, 3, 4, 9, 28], "toexclud": 11, "togeth": [1, 5, 6, 7, 8, 9, 11, 13, 16, 18, 23, 24, 27, 28, 34, 37, 38, 48, 49, 50], "toggl": 23, "togkousidi": 23, "toi": 5, "tokcan": 38, "tol": 37, "toler": [23, 37], "tolist": [4, 5, 17, 19, 27, 37, 44, 45, 46], "tolou": 24, "tom": [23, 24, 51], "toma": 23, "tomaso": 50, "tombor": 23, "tomer": [3, 4], "tommaso": [11, 38], "tomohiro": 5, "tong": [7, 11, 13, 25, 27, 28, 34, 36, 48], "toni": [13, 22], "too": [7, 8, 11, 13, 16, 19, 25, 27, 28, 34, 49], "took": [7, 16, 24], "tool": [0, 1, 2, 3, 4, 5, 6, 7, 8, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 40, 50, 51], "toolbox": [14, 16, 37], "toolkit": [1, 2, 4], "tools_4": 8, "toolz": [1, 7], "top": [0, 3, 5, 6, 7, 8, 11, 14, 15, 16, 19, 23, 26, 28, 31, 32, 33, 41, 49], "top10": [25, 41], "top2a": 51, "top_100_gen": 16, "top_10_clon": 3, "top_10_clust": 3, "top_gen": 51, "top_ligand": 25, "top_n": [25, 26], "top_tf": 26, "topic": [4, 5, 8, 9, 22, 23, 26, 30, 36], "topographi": [36, 40], "topolog": 25, "topologi": [6, 25, 49, 50], "toptag": 14, "torbj": 23, "torch": 7, "torchmetr": 7, "torlai": 7, "tormo": [25, 36, 41], "tornado": [1, 7, 15, 21, 25], "torrent": 24, "tosti": 40, "total": [1, 2, 5, 7, 8, 13, 14, 15, 16, 17, 21, 23, 33, 34, 36, 37, 41, 48, 49], "total_count": [11, 19, 21, 27, 28, 31, 33, 34, 37, 41, 43, 44, 45, 46, 47, 48], "total_count_upp": 11, "total_counts_hb": 34, "total_counts_mt": [21, 34, 37], "total_counts_ribo": 34, "total_fragment_count": 11, "touch": [21, 30], "toussaint": 50, "toward": [4, 5, 7, 9, 11, 14, 15, 16, 25, 51], "town": [14, 32], "towoard": 4, "toxic": 16, "toxin": 2, "toy_human_ref": 23, "toy_read_fastq": 23, "tp53": 49, "tpm": 7, "tprocess": 14, "tpu": [5, 7, 16, 27, 28, 36], "tpuplatform": 5, "tqdm": [1, 5, 6, 7, 15, 25, 50], "tqdmwarn": [5, 6, 15, 50], "tr": [4, 14], "tra": [1, 2, 4], "traag": [5, 6, 37, 50], "trac": [2, 27], "trace": 50, "traceback": 23, "tracer": [2, 49], "tracerlib": 1, "traci": [4, 5, 7, 50], "track": [3, 4, 7, 11, 16, 19, 27, 28, 34, 48, 49, 50, 51], "tracker": 30, "trade": [2, 4, 23, 51], "tradit": [23, 32, 49, 51], "tradition": [25, 30, 49, 50, 51], "train": [3, 4, 5, 11, 13, 19, 23, 27, 28, 36, 37, 43], "train_adata": 5, "train_adata_emb": 5, "train_genes_df": 38, "train_loss_epoch": [5, 16], "train_loss_step": [5, 16], "train_scor": 38, "train_siz": 36, "trainedencod": 3, "trainer": [5, 7, 16, 27, 28, 36], "training_gen": 38, "training_genes_df": 38, "training_histori": 38, "traitlet": [1, 7, 15, 21, 25], "traj": 4, "traj10": 4, "traj13": 4, "traj30": [2, 4], "traj31": [2, 4], "trajanoski": [2, 13, 19], "trajectori": [5, 6, 7, 11, 16, 17, 18, 19, 23, 28, 37, 49, 50, 51], "tran": [7, 26], "transact": 50, "transcrib": [9, 18, 23, 24, 51], "transcript": [2, 3, 5, 7, 8, 9, 11, 14, 15, 16, 17, 18, 23, 25, 26, 33, 34, 36, 38, 39, 41, 48, 49, 50, 51], "transcriptas": 18, "transcription": [5, 16], "transcriptom": [2, 4, 5, 7, 16, 17, 18, 19, 22, 25, 26, 28, 30, 31, 36, 37, 38, 39, 41, 44, 45, 47, 48, 49, 50, 51], "transcriptome_fasta": 23, "transdifferenti": 13, "transduct": [25, 48, 49], "transf_cell_typ": 5, "transf_cell_type_certain": 5, "transf_cell_type_unc": 5, "transfer": [1, 5, 7, 9, 10, 11, 16, 21, 27, 36], "transform": [3, 4, 5, 7, 11, 13, 15, 16, 17, 18, 19, 23, 31, 32, 33, 34, 37, 38, 40, 41, 42, 47, 50, 51], "transient": [23, 50, 51], "transit": [1, 5, 7, 12, 13, 15, 17, 18, 26, 29, 30, 42, 49, 50, 51], "translat": [1, 11, 13, 18, 23, 25, 34, 51], "transmit": 9, "transpar": [5, 42], "transplant": [1, 17], "transport": [25, 49], "transpos": [3, 4, 7, 11, 17, 19, 26, 34, 44], "transposas": 9, "transposit": [9, 11], "trap": [13, 24], "trape": 2, "trapnel": [5, 23], "trav": 4, "trav16": 2, "trav19": 1, "trav2": 4, "trav20": 4, "trav21": 4, "trav26": 4, "trav29": 1, "trav3": 4, "trav34": 2, "trav38": 4, "trav5": 4, "trav8": [2, 4], "travaglini": [5, 7, 50], "travi": [7, 24], "travlo": 1, "trb": [1, 2, 4], "trbc1": 2, "trbc2": [2, 5, 12], "trbd2": 1, "trbj": 4, "trbj1": [2, 4], "trbj2": [2, 4], "trbv": 4, "trbv10": [1, 4], "trbv11": 1, "trbv13": 4, "trbv14": 4, "trbv18": [1, 4], "trbv19": [1, 2], "trbv5": [1, 2, 4], "trbv6": 4, "trbv7": [1, 2, 4], "treaci": [7, 11, 27, 28, 34, 48], "treat": [14, 15, 16, 23, 25, 48], "treatment": [3, 13, 14, 15, 16, 22, 25, 48], "treatment_label": 16, "tree": [7, 13, 16, 27, 50], "tree_kei": 13, "trefzer": [24, 40], "treg": [2, 5], "trei": [15, 49], "trem1": 12, "tremend": 9, "trend": [14, 23, 30, 34, 36, 49], "trever": 49, "tri": [2, 7, 11, 16, 24, 51], "trial": [3, 18], "trial_": 3, "trial_0": 3, "trick": 28, "tricki": 13, "trigger": [1, 23, 25, 51], "triglia": 7, "trim": [3, 13, 18, 23], "trimm": 3, "trimmed_2_ful": 4, "trimodal_neurip": 27, "tripl": 49, "triticumaestivum": 4, "tritschler": 51, "trivial": 23, "trm": 5, "trna": 24, "trombetta": [23, 24, 49], "trrust": 26, "true": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 41, 44, 45, 46, 47, 48, 49, 50, 51], "true_divid": 17, "truli": [23, 25], "trust": [5, 38], "trustabl": 1, "truth": [13, 16, 25, 33, 49], "try": [1, 5, 6, 7, 13, 16, 17, 19, 21, 24, 25, 26, 36, 38, 49, 51], "trygv": 24, "ts16": 49, "ts_": 38, "tsagiopoul": 23, "tsai": 51, "tsang": 47, "tsankov": [5, 7, 50], "tse": [5, 48, 50], "tseng": 25, "tsg": 36, "tsne": [3, 26, 31, 50], "tsne1": [14, 15, 16, 25], "tsne2": [14, 15, 16, 25], "tsp": 4, "tss": [19, 26], "tss_cutoff_low": 11, "tss_enrich": [11, 19], "tss_fail": 11, "tss_filter": 11, "tss_pass": 11, "tss_score": 11, "tss_threshold": 11, "tss_upper": 11, "tsss": 26, "tsuji": 25, "tsv": [1, 2, 3, 10, 11, 19, 21, 23], "tt": [11, 14], "ttaat": 49, "ttccacggttgaggac": 27, "ttccctatttgcta": 49, "ttccctatttgctar2": 49, "ttccggtagttgtaag": [27, 28], "ttcgatttcaggacag": [27, 28], "ttcgatttctgaatcg": 23, "ttctcaaagaattccc": 3, "ttctct": 49, "ttctcttaatt": 49, "ttdpsflgry": 4, "ttest_ind": 17, "ttgen": 50, "ttir": 15, "ttll10": 3, "ttner": [5, 7, 13, 28, 50], "ttr": 41, "ttrust": 26, "tttatgctcgccgtga": 49, "tttcacgacaagct": 13, "tttcagtgaggcga": 13, "tttcagtgcgacat": 13, "tttcagtgtgacca": 13, "tttcagtgttctca": 13, "tttgcgcagctcctct": 49, "tttggttcatgtaaga": 49, "tttggttcatgttacg": 28, "tttggttgtcgtacta": 27, "tttggttgtctcacaa": 28, "tttggtttcacctcgt": 27, "tttggtttcccattcg": 28, "tttggtttccgtccta": 28, "tttggtttcgagaacg": 27, "tttggtttcgatacgt": 27, "tttggtttctgagtgt": 49, "tttggtttcttgcgct": 28, "tttgtcacacatccaa": 49, "tttgtcatctgtcaag": 49, "tttgttgagagtctgg": 28, "tttgttgcagacaata": 28, "tttgttgcatgttacg": 28, "tttgttggtagctttg": 27, "tttgttggtagtcact": 28, "tttgttggtccaatca": 27, "tttgttggtgactaaa": 27, "tttgttggtggcttcc": 11, "tttgttggttctttag": 11, "tttgttggttggccga": 11, "tttgttggtttacttg": 11, "tttgttggtttgtgga": 11, "tttgttgtccctctcc": 27, "tttgttgtcgcgctga": 28, "tttgttgtctagagct": 27, "tttgttgtctctgcca": 27, "tubb3": 41, "tucci": 48, "tuck": [5, 36], "tucker": 7, "tuesta": 16, "tuft": 13, "tuft_ix": 13, "tumor": [2, 3, 5, 17, 23, 24], "tumor_allele_t": 49, "tumor_clone_statist": 49, "tumor_nam": 49, "tumor_statist": 49, "tune": [5, 7, 16, 26, 27], "tuong": [1, 2, 5, 50], "tuoqi": 3, "tupl": [11, 15, 51], "turajl": 49, "turei": [15, 26], "turgai": 36, "turn": [2, 5, 13, 16, 21, 23, 43], "turnov": 50, "tushar": [5, 7, 50], "tutori": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 19, 21, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50], "twice": 24, "two": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 31, 34, 36, 37, 38, 40, 41, 45, 46, 47, 48, 49, 50, 51], "twork": 25, "twve19": 6, "txome": 23, "txp_to_gene_map": 23, "txt": [8, 17, 23, 26, 49], "tyk2": 15, "tyler": [7, 24, 49], "type": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 14, 17, 18, 19, 21, 24, 26, 27, 28, 29, 30, 31, 33, 34, 37, 39, 40, 41, 42, 43, 44, 47, 48, 49, 50, 51], "type_of_queri": 27, "typewrit": 49, "typic": [2, 3, 7, 13, 15, 19, 21, 23, 24, 25, 30, 31, 33, 34, 37, 38, 39, 41, 49, 51], "typing_extens": [1, 7, 15, 21, 25], "typist": 5, "tyrobp": [5, 12, 15], "tz": [7, 21], "tzdb_0": [8, 25], "tzlocal": [7, 15, 21, 25], "tzu": 14, "t\u00fcrei": 25, "u": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 19, 23, 24, 27, 28, 34, 36, 37, 38, 39, 40, 41, 45, 48, 51], "u_g": 51, "uba52": 15, "ube2": 26, "ube2l6": 16, "ubingazhibov": 7, "ubiquit": [23, 49], "ubund": 13, "ubuntu": [8, 25], "ucar": 11, "ucsc": [8, 10, 11], "udo": 24, "uduman": 1, "ufunc": [11, 36], "uhl": 37, "uhlen": 24, "uhlitz": 15, "uhrig": [17, 26], "ui": [7, 21], "ui59hvq5": 50, "uint32": 40, "uk": [3, 4, 5, 42], "ukov": 7, "ukw": 2, "ula": [17, 26], "ulrik": 50, "ultim": [5, 9, 23, 25], "ultra": [23, 24, 29, 50], "ultrafast": 23, "um": 39, "umap": [3, 5, 6, 8, 10, 11, 13, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 43, 44, 49, 51], "umap1": 8, "umap2": 8, "umap_0": 8, "umap_1": [10, 21], "umap_mofa": 28, "umap_multivi": 28, "umap_totalvi": 28, "umap_wnn": 28, "umd": 23, "umi": [2, 18, 24, 33, 34, 37, 47, 48, 49], "umic": 23, "umich": 23, "un": [4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 36, 37, 38, 40, 41, 43, 44, 45, 46, 50, 51], "una": 50, "unabl": [5, 21], "unalt": 23, "unambigu": 24, "unavail": [22, 30], "unbias": [11, 13, 17, 24, 36], "unbound": [26, 48], "uncert": 5, "uncertain": [5, 14], "uncertainti": [5, 13, 14, 23, 24, 29, 49, 51], "unchang": 13, "uncharacter": 16, "unclear": [5, 7, 13, 16, 17], "uncom": [4, 11], "uncommon": 7, "uncompress": 23, "unconstrain": 4, "uncorrect": [13, 23], "uncorrel": 31, "uncov": [17, 24, 29, 33, 50], "uncut": 49, "undefin": [13, 17], "under": [1, 2, 3, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 19, 21, 23, 25, 26, 27, 28, 30, 34, 36, 38, 40, 41, 49, 51], "undercount": 23, "underexpress": 14, "undergo": [3, 30], "undergon": 30, "underli": [2, 3, 4, 6, 13, 14, 17, 19, 23, 28, 31, 33, 34, 36, 37, 38, 41, 49, 50, 51], "underlin": 5, "underpin": [21, 30], "underpow": 13, "underrepres": 13, "undersampl": 51, "underscor": [10, 14, 21, 25], "understand": [1, 2, 5, 6, 8, 11, 13, 16, 17, 18, 21, 22, 24, 25, 30, 31, 33, 36, 39, 40, 41, 47, 48, 49, 50, 51], "understood": [19, 38, 50], "undertak": 7, "underutil": 3, "underwood": [23, 24], "undesir": 11, "undirect": [13, 37], "undissoci": 37, "uneven": [9, 18], "unexpect": [5, 11], "unfilt": [15, 34, 47, 48, 49], "unfold": [6, 49], "unfortun": [4, 13, 21, 24], "unicellular": 24, "unifi": [3, 13, 23, 26, 49], "uniform": [1, 13, 23, 31, 33, 38, 49], "uniform_dens": 38, "uniformli": [9, 13, 24], "unimod": [3, 9, 11, 21, 26, 27, 28, 29, 30, 48], "unimport": 0, "uninform": [11, 32, 49], "unintend": 34, "union": 27, "union1d": [25, 49], "uniqfrag": 11, "uniqu": [1, 2, 3, 4, 5, 8, 11, 13, 14, 16, 17, 18, 19, 23, 24, 25, 34, 38, 41, 42, 48, 49], "unit": [1, 2, 7, 9, 14, 15, 18, 24, 30, 41], "univ": 49, "univari": 13, "univers": [9, 23, 31, 49, 50], "unknown": [4, 5, 7, 21, 23], "unlabel": [7, 8], "unlabeled_categori": 7, "unlik": [3, 4, 5, 7, 15, 16, 18, 21, 38, 49], "unlist": 15, "unlock": [23, 51], "unlog": 3, "unment": 24, "unmethyl": 18, "unmix": 17, "unnam": [3, 19], "unnecessari": [4, 21], "unnorm": 19, "unnormalis": 7, "unobserv": [18, 49, 51], "unpair": [16, 29, 38], "unperturb": 16, "unpreced": [15, 25], "unprocess": 51, "unpromis": 23, "unrealist": 11, "unrel": 49, "unsatur": 49, "unscal": 7, "unseen": [5, 16], "unshrunk": 14, "unspecif": 5, "unsplic": [18, 21, 23, 50, 51], "unstabl": 25, "unstimul": 14, "unstructur": 11, "unsuit": 24, "unsupervis": [0, 4, 6], "unsupport": 21, "untarget": [2, 25], "untergass": 13, "until": [1, 2, 3, 4, 6, 7, 34], "untransl": 18, "untreat": [15, 16], "unusu": [5, 23], "unveil": [19, 24, 51], "unwant": [15, 18], "unwritten": 19, "up": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 32, 33, 38, 39, 43, 49, 50], "upadhyai": 2, "updat": [1, 2, 3, 4, 5, 6, 7, 15, 16, 19, 21, 22, 23, 25, 27, 29, 30, 46, 48, 50], "update_obs_column": 27, "upgma": 49, "upgrad": 25, "upload": 5, "upon": [2, 3, 13, 15, 19, 23, 24, 25, 29, 48, 49, 51], "upper": [1, 5, 8, 23, 28, 46, 48, 51], "uppercas": 26, "upregul": 16, "upstream": [1, 23], "upweight": 3, "uri": 1, "uri_templ": 21, "url": [2, 4, 5, 6, 9, 11, 13, 14, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "urllib": 5, "urllib3": [1, 21], "urlretriev": 5, "us": [1, 2, 3, 4, 5, 6, 9, 11, 13, 14, 16, 18, 21, 22, 24, 25, 27, 28, 29, 31, 32, 33, 34, 36, 37, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "usa": 23, "usabl": 5, "usag": [2, 7, 23, 24, 26, 37, 38], "use_batch": 27, "use_batch_norm": 27, "use_gpu": 36, "use_highly_vari": [5, 21, 27, 31], "use_hvg": 26, "use_lay": 27, "use_layer_norm": 27, "use_raw": [15, 25, 41], "use_rep": [5, 7, 13, 16, 19, 26, 27, 28, 31, 36, 38, 44], "user": [0, 4, 6, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 34, 36, 37, 49, 50], "user_guid": [1, 21], "user_instal": [5, 6, 15, 50], "userwarn": [1, 3, 4, 7, 11, 15, 17, 19, 25, 34, 36], "usr": 13, "usual": [2, 3, 5, 6, 7, 9, 13, 14, 16, 17, 18, 19, 21, 23, 24, 28, 31, 32, 34, 36, 37, 38, 39, 41, 43, 46, 48, 49, 50], "utc": [7, 21, 50], "utf": [7, 8, 14, 15, 21, 25, 27, 28], "utf8": [7, 21], "utf8_1": [8, 25, 27, 28], "util": [1, 2, 3, 4, 5, 7, 8, 11, 13, 15, 17, 21, 24, 25, 27, 28, 33, 34, 36, 41, 48, 49], "utils_1": 8, "utils_2": 8, "utils_3": [25, 27, 28], "utils_preprocess": 3, "utils_train": 3, "utr": 18, "uuid_1": 8, "uw": 7, "uwot": [7, 21], "uwot_0": [25, 27, 28], "uytingco": 37, "v": [1, 4, 5, 6, 7, 13, 14, 23, 25, 26, 27, 36, 46, 48, 49, 50, 51], "v0": [1, 2, 3, 4, 21], "v1": [7, 27, 28], "v1_adult_mouse_brain": 37, "v1_adult_mouse_brain_imag": 37, "v2": [23, 25, 37], "v3": [7, 23], "v32": 23, "v4": 27, "v7": 15, "v86": 10, "v9": 26, "v_a_gen": 4, "v_adata": 16, "v_b_gene": 4, "v_call": 1, "v_call_b_vdj": 1, "v_call_b_vj": 1, "v_call_vdj": 1, "v_call_vj": 1, "v_cigar": 1, "v_field": 1, "v_gene": 2, "v_i": 23, "v_j": 23, "v_num": [5, 7, 16, 27, 28, 36], "v_result": 16, "vaccarino": 49, "vaccin": [3, 4], "vaccine": 4, "vae": [16, 27, 28], "vae_loss": 27, "vae_q": 27, "vafadarnejad": [17, 26], "vahid": 24, "vaibhao": 23, "vaidota": 50, "vaishnav": 7, "val": [3, 27, 36, 51], "val_dataload": 36, "val_split": 3, "valdeoliva": 25, "valeh": 7, "valent": [23, 24], "valentin": [7, 24, 41], "valentina": [13, 25], "valeri": [8, 9, 19, 22], "valid": [2, 3, 4, 5, 8, 11, 13, 14, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 49], "validation_step": 36, "valient": 23, "valin": 24, "valiollah": 7, "valkier": 2, "vallei": 48, "vallejo": 14, "valu": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 32, 33, 36, 37, 38, 41, 42, 47, 48, 49, 50], "valuabl": [1, 5, 22, 24, 48, 50], "value_count": [1, 2, 3, 4, 7, 11, 16, 17, 26, 34, 47, 48], "values_to_plot": 43, "vamp3": 3, "vamsi": 15, "van": [5, 6, 7, 13, 14, 16, 23, 25, 26, 31, 36, 49, 50, 51], "vander": 1, "vanderburg": 38, "vanessa": 48, "vanhorn": 49, "vanillagreedi": 49, "vanillagreedysolv": 49, "var": [3, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 49, 50, 51], "var2_": 19, "var2_48": 19, "var2_49": 19, "var2_50": 19, "var_": 19, "var_ad2_": 19, "var_ad2_48": 19, "var_ad2_49": 19, "var_ad2_50": 19, "var_group_label": 16, "var_nam": [5, 10, 11, 13, 14, 17, 19, 21, 25, 26, 27, 28, 32, 34, 36, 37, 38, 41], "var_names_make_uniqu": [11, 19, 34, 37, 41, 43], "var_norm": 41, "varela": 24, "vari": [2, 4, 5, 7, 11, 13, 16, 17, 23, 24, 25, 28, 30, 33, 36, 37, 39, 41, 47], "variability_scor": 28, "variabl": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 21, 23, 26, 27, 28, 31, 32, 33, 34, 36, 37, 40, 43, 45, 49, 50, 51], "variablefeatur": [27, 28], "varianc": [6, 7, 13, 14, 15, 17, 21, 31, 32, 33, 37, 38, 41, 50], "variance_ratio": 21, "variances_norm": [15, 37], "variant": [7, 23, 24, 49], "variat": [3, 5, 8, 13, 14, 15, 17, 19, 23, 25, 26, 27, 32, 33, 36, 41, 47, 49, 50, 51], "varieti": [1, 2, 4, 5, 23, 24, 30, 33], "variou": [2, 3, 7, 9, 15, 17, 19, 21, 23, 24, 25, 27, 29, 34, 39, 40, 48, 49], "varm": [5, 7, 13, 14, 15, 19, 21, 27, 28, 36, 37, 43, 45], "varp": [10, 19, 21], "vasilopoul": 29, "vast": [16, 29], "vaz": 15, "vbac016": 15, "vcallcolumn": 1, "vcan": [5, 12], "vcenter": 13, "vctr": [7, 21], "vctrs_0": [8, 25, 27, 28], "vd1": 12, "vdj": [1, 4], "vdj_usag": 1, "vdjdb": 4, "vdjdb_overlap": 4, "vdjpuzzl": 2, "vdjx": 1, "vdvg": 2, "ve": 49, "vector": [3, 5, 6, 11, 14, 16, 17, 19, 23, 24, 31, 32, 34, 36, 38, 49, 50, 51], "veiga": [7, 23, 51], "vel": 26, "velculescu": 49, "velobiri": 51, "veloblp": 51, "velobptd": 51, "velobskt21": 51, "veloc": [18, 21, 22, 23, 50], "velocity_embedding_stream": 51, "velocity_graph": 51, "velocity_umap": 51, "velockh": 51, "velocyto": 21, "velogbw22a": 51, "velogbw22b": 51, "velogwl": 51, "velohz": 51, "velolbk": 51, "velombl": 51, "velomlbd": 51, "velomsz": 51, "veloqh21": 51, "velorod": 51, "velosm": 51, "velozkostlerm": 51, "velozsobrienb": 51, "velten": 28, "veltrop": 36, "vendorlot": [7, 27, 28], "venep": 24, "vento": [25, 36, 41], "ventura": 21, "vera": 13, "verbandt": 2, "verbos": [3, 6, 11, 14, 21, 25, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "vere": [17, 24], "veri": [0, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 31, 36, 38, 43, 44, 45, 49], "verif": 26, "verifi": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "vernon": 7, "veronika": [2, 36, 43], "verovskaya": 49, "versa": 23, "versatil": [2, 23], "version": [4, 5, 6, 7, 8, 10, 11, 15, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 50], "versu": [1, 5, 6, 8, 9, 11, 14, 15, 21, 23, 24, 32, 49], "vertebr": 50, "vertex": 23, "vertic": [11, 18, 23], "veter": 17, "vh": 4, "vhh": 4, "vhyu": 1, "via": [1, 2, 3, 7, 8, 13, 15, 16, 19, 21, 23, 25, 27, 28, 29, 31, 34, 36, 38, 39, 49], "viabil": 16, "viabl": [1, 34, 48], "vibrat": 2, "vice": 23, "vicin": 25, "vickov": 38, "victor": [14, 17, 24, 26, 49], "victoria": 23, "vidal": 13, "vide": 26, "video": [9, 19, 23], "vidya": 49, "vieira": 23, "vieth": [23, 24], "view": [1, 2, 4, 5, 7, 13, 14, 15, 16, 21, 23, 24, 25, 28, 29, 38, 40, 48, 49], "view_anndata_setup": [7, 36], "viewport": 8, "vignali": 4, "vigneault": 1, "vignett": [16, 19, 21, 27, 28], "vijai": [16, 48, 50], "vijaya": 50, "viktor": [50, 51], "vila": [24, 49], "villani": [7, 11, 24, 27, 28, 34, 48], "vim": 25, "vinai": [7, 8], "vinc": [17, 22], "vincent": [6, 7, 19, 22, 50], "vinh": [17, 26], "vink": 36, "vinyard": 11, "violain": 51, "violat": [23, 34, 51], "violin": [11, 16, 19, 34, 46, 50], "violinplot": 38, "vipor_0": 8, "viral": 1, "virgini": 24, "viridislit": [7, 21], "viridislite_0": [8, 25, 27, 28], "virshup": [19, 21, 37, 40, 41], "viru": [4, 24], "vis_ligand_target": 25, "visan": 17, "vishwaraj": 5, "visibl": [16, 42, 48, 50], "vision": 15, "visit": [9, 11, 25, 31, 41], "visium": [36, 37, 38, 39], "visium_hne_adata": [37, 40, 41], "visnetwork_2": 25, "visual": [0, 1, 3, 4, 5, 6, 7, 9, 10, 11, 13, 19, 23, 26, 27, 28, 30, 31, 34, 36, 37, 40, 43, 44, 45, 46, 51], "visualis": [3, 7, 17, 32], "visvad": 5, "viswanathan": 24, "vita": 4, "vital": 24, "vitalii": [7, 36], "vitessc": 21, "vitro": 49, "vivian": 14, "vivo": [3, 25], "viz": [8, 11], "viztyp": [1, 3], "vj": [1, 2, 4], "vl": 4, "vladimir": [7, 15, 25], "vm21": 49, "vmax": [5, 13, 36], "vmin": [5, 13, 36], "voet": 30, "vogelstein": 49, "volcano": [13, 14], "volcano_plot": 14, "volik": 23, "volk": [17, 26], "volker": [5, 50, 51], "volum": [7, 24, 50], "von": [5, 7, 17, 26, 50], "vorholt": 50, "vote": 5, "vpreb1": [5, 12], "vpv": 49, "vqythfpyt": 4, "vqyvqfpyt": 4, "vrij": 2, "vrooman": 4, "vsmc": 36, "vst": 17, "vukov": 37, "vulner": 24, "vwf": 38, "vyatkin": 16, "w": [1, 4, 5, 7, 9, 14, 15, 16, 19, 23, 24, 26, 30, 34, 36, 41, 49, 50], "w2": 19, "w_": 41, "wa": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "waddington": 49, "wadsworth": [7, 24], "wagar": [3, 4], "wagenstett": 5, "waghrai": 7, "wagner": [3, 5, 6, 7, 16, 17, 23, 36, 49, 50], "wai": [1, 2, 3, 5, 7, 9, 11, 13, 14, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 36, 37, 38, 41, 48, 49, 51], "wakimoto": 49, "walczak": 1, "waldman": 7, "waldmann": 24, "waldron": [19, 22], "walk": [9, 50], "walker": [39, 41, 48], "walkthrough": 49, "wall": [14, 15], "walsh": [24, 49], "walter": [5, 23, 24], "waltman": [5, 6, 50], "walzthoeni": [5, 7, 50], "wan": [14, 15, 16, 23, 25, 43], "wang": [2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 23, 24, 25, 26, 27, 28, 31, 34, 37, 38, 39, 41, 48, 49], "want": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 48, 49], "wanwan": 41, "wanz": 50, "waradon": [1, 2], "ward": 4, "ward_o2": 2, "ware": 5, "warm": 23, "warmer": 23, "warn": [1, 2, 3, 4, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 26, 27, 28, 34, 37, 38, 41, 47], "warn_names_dupl": [11, 34], "warnung": [11, 21], "warrant": 23, "wash": 2, "wat18": 2, "watano": 49, "watch": 49, "water": 23, "waterman": 23, "watson": 24, "wavefront": 23, "waveguid": 24, "way": 49, "wcwidth": [1, 7, 15, 21, 25], "we": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "weak": [3, 4, 13, 24], "web": [3, 4, 15, 17], "webapp": 4, "webb": [23, 50], "webcolor": 21, "weber": [2, 6, 23], "webpag": [5, 23], "webshot": [8, 11], "webshot_0": 8, "websit": [23, 37, 49], "websocket": [1, 21], "wedg": 49, "weed": 1, "wei": [4, 7, 14, 15, 16, 24, 37, 40, 44, 49], "weichert": 40, "weight": [1, 3, 5, 7, 8, 13, 25, 26, 27, 36, 37, 38, 41, 42, 51], "weight_decai": [5, 27], "weighted_knn_train": 5, "weighted_knn_transf": 5, "weiler": [50, 51], "weili": 17, "weimin": 37, "weinand": 5, "weinreb": [49, 50], "weiss": [17, 43], "weissman": [38, 49], "weitz": [23, 24], "weixiang": 49, "welch": 51, "well": [1, 2, 3, 4, 5, 6, 7, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 29, 30, 33, 34, 36, 37, 38, 40, 46, 47, 48, 49, 50, 51], "wen": [36, 38, 43, 49], "wencan": 31, "wendi": [7, 13, 22, 48, 50], "wendisch": [17, 26], "weng": 5, "wenhua": 2, "wenji": [24, 39], "wenjuan": 49, "wenjun": [7, 49], "wenqiang": 16, "wensi": 4, "went": 11, "wenwei": 37, "wenyan": 5, "were": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 34, 36, 39, 49, 51], "weslei": 25, "wessel": 16, "west": 2, "wet": 24, "wget": [2, 3, 4, 7, 15, 23, 26, 49], "wgw17": 49, "what": [0, 2, 3, 4, 5, 8, 9, 14, 15, 16, 19, 21, 23, 25, 26, 27, 29, 36, 40, 42, 48, 49], "whatev": 7, "wheeler": [23, 24], "when": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 42, 48, 49, 50], "whenev": [14, 21, 51], "where": [1, 2, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50], "wherea": [1, 2, 5, 8, 15, 16, 17, 19, 24, 34, 40, 41, 49], "wherebi": 15, "wherein": 23, "wherev": 30, "whether": [2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 18, 23, 25, 30, 32, 34, 36, 38, 40, 41], "whh": 49, "which": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 48, 49, 50, 51], "while": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 33, 36, 38, 39, 43, 48, 49, 50, 51], "whisker": 23, "white": [5, 6, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49], "whitegrid": 11, "whitelist": 23, "whitsett": [5, 7, 50], "who": [5, 13, 19, 22], "who_per_sampl": 17, "whole": [2, 7, 19, 21, 23, 24, 38, 39, 48, 49, 51], "whole_blood": 17, "whose": [1, 19, 34, 38], "whp": 6, "why": [3, 4, 7, 8, 10, 16, 18, 24, 30, 34, 38], "wickersham": 24, "wide": [1, 4, 5, 9, 14, 15, 16, 21, 23, 24, 31, 33, 38, 39, 47, 49], "wider": [4, 16, 23], "widespread": [23, 24], "widest": 2, "width": [3, 8, 11, 42], "wien": 5, "wiki": 23, "wilbrei": [5, 7, 50], "wilcoxon": [5, 13, 14, 16], "wild": 38, "wilei": [6, 13, 14, 24], "wilk": [5, 14, 19, 25, 27, 28], "wilko": 40, "willi": 49, "william": [4, 5, 7, 8, 9, 14, 16, 19, 23, 24, 27, 28, 32, 37, 47, 48, 49, 50, 51], "wilson": [2, 4, 23, 24, 48, 50], "wim": 5, "window": [9, 49], "wing": [48, 50], "wire": 24, "wise": [14, 36, 38, 39, 46], "wish": [22, 23, 25], "wit": 49, "with_info": 19, "withdraw": 16, "withdraw_15d_cocain": 16, "withdraw_48h_cocain": 16, "within": [2, 3, 4, 6, 7, 8, 9, 10, 11, 14, 15, 16, 17, 18, 21, 22, 23, 25, 26, 27, 28, 32, 34, 36, 37, 38, 49, 50, 51], "within_sample_network": 3, "without": [0, 1, 2, 3, 4, 5, 7, 14, 15, 21, 23, 24, 26, 31, 34, 37, 41, 49], "withr_2": [8, 25, 27], "witzenrath": [17, 26], "wiv": 4, "wk20": 49, "wk3kbll507v4h18f8nmbzkl80000gq": 49, "wkmacleann19": 25, "wknn": 28, "wnn_connect": [21, 28], "wnn_distanc": 21, "wnn_ref": [27, 28], "wnn_umap": 21, "wnn_umap_": 21, "wnnumap_": [21, 28], "wnnumap_1": 21, "wolabaugh": 2, "wolf": [2, 6, 7, 13, 16, 19, 50, 51], "wolfgang": [14, 19, 22, 23, 24, 33, 51], "wolfram": 25, "wolock": [17, 23], "won": [14, 15, 28], "wonder": 13, "wong": [14, 15, 16, 23, 24, 25, 48], "woo": 3, "woodworth": 49, "word": [15, 23, 25], "work": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 27, 28, 30, 32, 33, 37, 38, 39, 40, 41, 44, 49, 50, 51], "workflow": [1, 2, 3, 4, 7, 11, 13, 15, 18, 19, 21, 22, 23, 24, 30, 32, 41, 43, 50, 51], "workspac": [10, 17, 27, 28], "world": [16, 19, 51], "worlock": [1, 2, 5, 7, 50], "wors": [7, 17], "worsen": 5, "worst": 7, "worst_clinical_statu": 2, "worth": [1, 5, 19, 31, 34, 36, 49], "worthwhil": 7, "would": [0, 1, 5, 6, 7, 11, 13, 14, 15, 16, 19, 23, 25, 26, 27, 28, 33, 34, 36, 38, 45, 47, 48, 49, 50, 51], "wouldn": 7, "wouter": [8, 9, 25, 26, 50], "wozniak": 23, "wp15": 49, "wr16": 6, "wrammert": 2, "wrap": [1, 4, 11, 19, 21], "wrapper": [7, 23], "wrapt": 7, "wrfck20": 49, "write": [1, 2, 3, 5, 8, 11, 15, 17, 23, 31, 32, 33, 34, 38, 44, 45, 46, 47, 48, 49, 50], "write_h5ad": [11, 21], "write_h5mu": 21, "writeh5ad": 21, "writeh5mu": 21, "writer": 21, "written": [0, 7, 19, 23, 25], "wrna": 24, "wrong": [4, 5], "wrongli": [3, 5, 14, 34], "wrote": [21, 50], "wry16": 6, "wshb22": 25, "wsnn": 28, "wspace": [5, 7, 13, 15, 16, 37], "wu": [3, 7, 8, 14, 15, 25, 37, 49, 50], "wume": 49, "wwn": 28, "www": [3, 4, 5, 9, 13, 14, 17, 19, 22, 23, 24, 25, 27, 28, 29, 31, 33, 34, 37, 39, 40, 47, 48, 50], "wyatt": [23, 24], "wyler": [17, 26], "wzc": 25, "w\u00fcnnemann": 36, "x": [2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 41, 44, 45, 46, 47, 48, 49, 50, 51], "x2013": 17, "x27": [11, 13, 16, 19, 28, 44, 45, 46, 47, 48], "x86_64": [1, 7, 8, 15, 21, 25, 27, 28], "x_": 36, "x_adt_elbo": 27, "x_adt_kl": 27, "x_adt_nll": 27, "x_approximate_distribut": 36, "x_arrai": 37, "x_diffmap": 50, "x_glue": 27, "x_harmoni": 36, "x_i": [34, 41], "x_isotyp": [27, 28, 43, 45], "x_lsi": 19, "x_mofa": [21, 28], "x_mofa_umap": 21, "x_multivi": 28, "x_name": 21, "x_pca": [7, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 31, 36, 37, 43, 45, 51], "x_pcahm": [27, 28, 43, 44], "x_pert": 16, "x_pixel": 37, "x_rna_elbo": 27, "x_rna_kl": 27, "x_rna_nll": 27, "x_scanvi": 7, "x_scvi": [5, 7, 13], "x_spca": 28, "x_totalvi": [27, 28], "x_totalvi_scarch": 27, "x_tsne": [26, 50], "x_tsne_aucel": 26, "x_umap": [5, 7, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 43, 44, 45, 51], "x_umap_aucel": 26, "x_umap_mofa": 28, "x_umap_multivi": 28, "x_umap_totalvi": 28, "x_umap_wnn": 28, "x_wnn_umap": 21, "xavier": [13, 22], "xbp1": [5, 12], "xcell": 17, "xenograft": 49, "xfun_0": [8, 25], "xi": [34, 37, 48], "xiaji": 16, "xian": [24, 36], "xiang": [31, 37, 41], "xiangji": [37, 41], "xiannian": 24, "xiant": 48, "xianwen": 24, "xiao": 37, "xiaofeng": [4, 37], "xiaohui": 49, "xiaoji": [23, 37, 50], "xiaojun": 4, "xiaol": [50, 51], "xiaoman": 25, "xiaomeng": [7, 9], "xiaot": 36, "xiaowei": 38, "xiaowen": 31, "xiaoyang": 25, "xiaoyu": 37, "xie": [9, 48, 49], "xiliang": 24, "ximeng": 49, "xin": [2, 5, 26, 37], "xinfeng": [36, 38], "xing": [7, 31, 37], "xingfan": 23, "xinghua": 38, "xingxu": 39, "xingyi": 7, "xinhai": 49, "xinlei": 3, "xinxin": [9, 15], "xiny": [36, 38], "xinzhu": 9, "xiong": 3, "xirp2": 36, "xiut": 7, "xiuwei": 49, "xiuxiu": 49, "xiuyuan": 13, "xiuzhen": 49, "xla": 5, "xla_extens": 5, "xlabel": [3, 4, 13, 16, 17, 48, 49], "xlim": 26, "xml_3": 8, "xpro": 34, "xtabl": [7, 21], "xtable_1": [8, 25, 27, 28], "xtick_rot": 1, "xticklabel": [4, 25, 26], "xu": [4, 5, 7, 15, 17, 26, 31, 36, 37, 38, 49, 50], "xue": [36, 38], "xuehai": 5, "xuei": 49, "xuesong": 25, "xuetong": [36, 38], "xueyi": [14, 23], "xuhuai": [3, 4], "xun": 37, "xvector": [7, 21], "xvector_0": [8, 15, 27, 28], "xvzf": 49, "xwy": 31, "xy": 37, "xytext": 7, "xzf": 23, "y": [1, 3, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 32, 33, 36, 37, 38, 44, 46, 48, 49, 50, 51], "y2": 19, "y_": [16, 33, 36], "y_0": 33, "y_arrai": 37, "y_pixel": 37, "y_pred": 37, "yaari": 1, "yajima": [14, 34], "yak": 2, "yakubova": 16, "yal": 4, "yaml": [1, 7, 21, 50], "yaml_2": 8, "yamlordereddictload": 1, "yan": [4, 5, 7, 8, 11, 15, 27, 28, 34, 37, 40, 48, 49, 50], "yanai": 17, "yanfang": 38, "yang": [3, 4, 7, 9, 11, 13, 14, 17, 25, 26, 27, 28, 31, 34, 37, 38, 39, 48, 49], "yanmei": 49, "yansheng": 48, "yanxiao": 9, "yanyan": 3, "yanyi": 24, "yanyu": 26, "yao": [3, 24, 25, 36, 38, 49], "yaoxian": 36, "yaqi": 24, "yarden": [13, 22, 51], "yaru": 15, "yasha": 24, "yasmin": 51, "yate": 2, "yde": 50, "ye": [15, 23, 24, 37, 47, 48], "year": [13, 19, 24, 28, 36, 39], "yeast": 25, "yee": 7, "yellow": 23, "yeng": 37, "yeong": 26, "yermano": 2, "yet": [3, 5, 7, 8, 16, 19, 23, 25, 27, 30, 40, 44, 49], "yeung": [5, 14, 16, 19, 27, 28, 48, 50], "yfv": 4, "yi": [16, 17, 49], "yichen": 51, "yield": [3, 19, 23, 25, 31, 49, 51], "yifang": [14, 15], "yii": 25, "yilmaz": [13, 22], "yin": 37, "yine": 7, "ying": [5, 37, 49], "yingxin": 13, "yinlei": [36, 38], "yiqi": 3, "yiwei": 37, "yixuan": 5, "yiyun": 49, "yjn": 49, "ylabel": [4, 13, 16, 48, 49], "ylgnbu": 33, "ylqprtfll": 4, "ymax": 26, "ymin": 26, "ymk": 49, "yml": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "yoav": [14, 51], "yofe": 36, "yohan": 5, "yohei": 24, "yonatan": 28, "yong": [3, 26], "yoon": 49, "yoram": 4, "yosef": [5, 6, 7, 9, 14, 15, 27, 28, 36, 38, 44, 49, 50, 51], "yoseflab": 49, "yoseph": 36, "yoshida": [1, 2, 5, 7, 50], "yoshihiko": [5, 7], "yost": 3, "you": [1, 2, 3, 4, 5, 7, 9, 10, 11, 13, 14, 15, 17, 19, 21, 23, 25, 26, 27, 28, 30, 34, 36, 38, 40, 44, 47, 48, 49, 50], "young": [7, 23, 29, 34, 49], "youp": 49, "your": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "yourself": 5, "youtub": 19, "yscale": 49, "ysebaert": 24, "ysw": 3, "yticklabel": [4, 26], "yu": [7, 15, 25, 26, 43, 49], "yuan": [16, 37, 47, 48], "yuanhua": 51, "yue": [5, 13, 23, 37, 39, 49], "yuejuan": 26, "yuexin": [5, 24], "yuge": [5, 16], "yuhan": [5, 7, 14, 16, 19, 27, 28, 48, 50], "yujia": [15, 37], "yuki": 23, "yukuan": 15, "yulia": 49, "yun": [15, 26, 49], "yung": 15, "yunhe": 26, "yunlong": 15, "yuntian": 37, "yunusov": 23, "yunzhi": 37, "yuqiu": 3, "yuri": 16, "yurii": [7, 44], "yusuk": [34, 48, 49, 50], "yuval": [1, 13, 25], "yuxiang": [37, 39], "yuxuan": 25, "yvan": [25, 50], "yvhu": 1, "yytsnpttf": 4, "z": [5, 6, 7, 8, 13, 15, 16, 17, 19, 23, 24, 36, 37, 38, 40, 48, 50], "z_": 41, "z_corr": 44, "z_i": 41, "z_iz_j": 41, "zach": 8, "zachara": 50, "zachari": [23, 24, 49], "zack": 49, "zadeh": [14, 15], "zagar": [14, 19], "zager": [5, 27, 28], "zaitsev": 17, "zajac": [23, 24, 50], "zakari": 49, "zakeri": [23, 51], "zakharov": 16, "zaleski": 23, "zambelli": 50, "zaneta": 7, "zappia": [5, 7, 21, 23, 28, 30, 34, 50], "zaragosi": [5, 7, 50], "zarnitsyna": 2, "zarr": [1, 18, 19, 21, 50], "zavaleta": 26, "zcw": 3, "zdim": 3, "ze": [2, 3], "zeglinski": 14, "zehua": [50, 51], "zeisel": [23, 24, 50, 51], "zelikovski": 14, "zellkonvert": [11, 21], "zellkonverter_1": 8, "zellkonverter_h5ad_fil": 21, "zemin": 24, "zeng": [5, 24], "zenodo": [2, 11, 25, 49], "zero": [5, 7, 8, 9, 11, 13, 14, 15, 23, 24, 27, 32, 34, 36, 48], "zero_cent": 21, "zeth": 19, "zev": [11, 23], "zewen": [1, 2, 50], "zeyao": 24, "zeynep": [4, 26], "zhang": [2, 3, 4, 5, 7, 9, 11, 13, 15, 16, 17, 22, 23, 24, 25, 26, 27, 28, 34, 36, 37, 38, 41, 44, 48, 49, 51], "zhanlin": 51, "zhao": [7, 13, 15, 25, 36, 37, 38], "zhaohui": 37, "zhaoyang": 25, "zhe": [5, 34], "zhen": [4, 9], "zheng": [5, 14, 16, 19, 23, 24, 25, 27, 28, 37, 47, 48, 51], "zhenmao": 23, "zhi": [7, 27], "zhibao": 5, "zhichao": 7, "zhifeng": 37, "zhijian": 36, "zhou": [5, 9, 15, 41, 49], "zhu": [5, 23, 24, 37, 41, 49], "zhuang": 38, "zichen": 15, "zicheng": 17, "ziegenhain": [23, 24], "ziegler": [7, 36], "zimmerman": 14, "zinb": 7, "zip": [3, 13, 14, 15, 21, 27, 28], "zipp": [1, 7, 15, 21], "zippeliu": 17, "ziqe": 38, "ziqi": 50, "ziraldo": [23, 24], "zixuan": [25, 39, 41], "ziyu": 26, "zizhen": [24, 49], "zjt": 47, "zlatko": [2, 13, 19], "zlh": 25, "zlibbioc": [7, 21], "zlibbioc_1": [8, 15, 27, 28], "zlm": 14, "zlmcond": 14, "zlw": 25, "zmi18": 49, "zmq": [1, 7, 15, 21, 25], "znf215": [5, 12], "znf385d": [5, 12], "znf471": 8, "znrf1": 8, "zo": [27, 28], "zoe": 49, "zone": 36, "zoneinfo": [7, 15, 21, 25], "zong": 23, "zoo": [7, 21], "zoo_1": [25, 27, 28], "zoom": [8, 11, 48], "zorder": 11, "zorzetto": [48, 50], "zou": [25, 36], "zquez": 26, "zscore": 40, "zt21": 30, "zumi": 23, "zvyagin": 4, "zwl": 4, "zxw": 3, "zzt": 25, "\u00df": [17, 26], "\u00e1": [5, 7, 8, 15, 23, 24, 26, 37, 50, 51], "\u00e2": [15, 26], "\u00e4": [14, 15, 17, 23, 24, 26, 50], "\u00e5": 7, "\u00e5sa": 38, "\u00e7": [4, 8, 50, 51], "\u00e8": [19, 22], "\u00e9": [2, 5, 7, 14, 15, 16, 17, 19, 22, 23, 24, 26, 28, 37, 49, 50, 51], "\u00eb": [27, 28], "\u00ed": [26, 49], "\u00ed\u00f1": 23, "\u00f1": [2, 37, 50], "\u00f3": [5, 7, 13, 15], "\u00f6": [7, 14, 15, 17, 23, 24, 26, 50, 51], "\u00f8": 23, "\u00fa": 15, "\u00fc": [5, 7, 11, 13, 15, 17, 23, 24, 25, 26, 27, 28, 31, 34, 48, 50], "\u0107": 50, "\u011f": 4, "\u0131": [4, 5, 23], "\u0144": 7, "\u0148": 7, "\u015b": [19, 22], "\u015f": 4, "\u017e": 5, "\u0263": 2, "\u03b1": [2, 4], "\u03b1\u03b2": 2, "\u03b2": [2, 4, 14, 24, 25], "\u03b21": 16, "\u03b3": 2, "\u03b4": 2, "\u03ba": 2, "\u03bb": 2, "\u2139": 21}, "titles": ["49. Acknowledgements", "39. Clonotype analysis", "38. Immune Receptor Profiling", "44. Integrating AIR and transcriptomics", "43. Specificity analysis", "11. Annotation", "10. Clustering", "12. Data integration", "25. Gene regulatory networks using chromatin accessibility", "23. Single-cell ATAC sequencing", "Conversion of muon objects to Seurat objects to use in downstream analysis", "24. Quality Control", "Markers for cluster annotations across modalities", "17. Compositional analysis", "16. Differential gene expression analysis", "18. Gene set enrichment and pathway analysis", "19. Perturbation modeling", "22. Bulk deconvolution", "50. Glossary", "4. Analysis frameworks and tools", "Data infrastructure", "5. Interoperability", "1. Prior art", "3. Raw data processing", "2. Single-cell RNA sequencing", "21. Cell-cell communication", "20. Gene regulatory networks", "46. Advanced integration", "45. Paired integration", "48. Outlook", "Single-cell best practices", "9. Dimensionality Reduction", "8. Feature selection", "7. Normalization", "6. Quality Control", "47. Reproducibility", "30. Spatial deconvolution", "28. Spatial domains", "31. Imputation", "26. Single-cell data resolved in space", "27. Neighborhood analysis", "29. Spatially variable genes", "<no title>", "37. Annotation", "36. Batch correction", "35. Dimensionality Reduction", "34. Doublet detection", "33. Normalization", "32. Quality control", "15. Lineage tracing", "13. Pseudotemporal ordering", "14. RNA velocity"], "titleterms": {"": [25, 27, 41], "1": 25, "19": 17, "2": 25, "3": 25, "3726_nt_t1": 49, "4": 25, "5": 25, "A": [7, 15, 23, 24, 36], "In": 21, "On": 15, "One": 14, "The": [23, 24, 51], "Will": 13, "With": 13, "about": 13, "abund": [1, 13], "access": [8, 19, 21], "acknowledg": 0, "across": [12, 40], "activ": [15, 25], "ad": 19, "adapt": 2, "adt": [12, 27], "adult": 50, "advanc": [19, 27], "affect": [16, 25], "against": 23, "air": [2, 3], "alevin": 23, "algorithm": 49, "align": [2, 19, 23], "altern": 30, "ambient": 34, "an": [7, 19, 23, 27], "analys": 16, "analysi": [1, 2, 3, 4, 9, 10, 13, 14, 15, 16, 19, 22, 26, 28, 36, 40, 49], "analyt": 33, "anndata": [19, 21], "annot": [5, 12, 43], "api": 19, "appl": 23, "approach": [17, 25], "art": 22, "assai": [9, 10], "assign": 2, "assumpt": 25, "atac": [8, 9, 12], "atla": [27, 29], "attribut": 19, "aucel": 15, "augment": 23, "augur": 16, "author": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "autoencod": [7, 16], "autom": [5, 43], "awar": 7, "background": 17, "barcod": 23, "base": [5, 7, 11, 21, 23, 24, 36], "batch": [7, 13, 44], "bcr": [1, 3, 4], "benchmark": [7, 29], "beniss": 3, "best": [22, 30], "between": [13, 15, 21, 38, 40], "bioconductor": [21, 22], "biolog": 13, "block": 24, "blood": 17, "bone": [6, 50], "book": [22, 30], "bound": 11, "bridg": 27, "brief": [23, 24], "build": [7, 23, 24, 27, 29], "bulk": [15, 17], "c1": 24, "calcul": [7, 11, 16, 49], "can": 25, "cancer": 49, "case": [15, 25], "cassiopeia": 49, "ccc": 25, "cd4": 16, "cd4t": 16, "cell": [2, 6, 7, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 29, 30, 34, 36, 38, 39, 46], "cell2loc": 36, "cellrang": 48, "cellular": 39, "center": 47, "characterist": 9, "choos": 7, "chromatin": [8, 10], "cistop": 8, "citat": 30, "cite": 28, "classifi": 5, "clonal": 1, "clonotyp": 1, "cluster": [3, 5, 6, 12, 13, 15], "co": 40, "collect": [15, 48], "combin": 25, "common": [19, 38], "commun": [25, 40], "comparison": [1, 7, 15], "complet": [23, 48], "complex": [7, 15], "composit": 13, "comput": [38, 49], "conclus": 49, "condit": [3, 13], "configur": 27, "conga": 3, "consensu": 25, "consid": 25, "consider": 15, "consortia": 19, "construct": [16, 27, 38, 50], "contact": 30, "contribut": [25, 30], "contributor": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "control": [2, 11, 15, 23, 31, 34, 48], "convers": [10, 19], "convert": [8, 10], "copi": 19, "correct": [7, 13, 23, 34, 44], "count": [11, 13, 23], "cours": 49, "cover": 30, "coverag": 11, "covid": 17, "creat": 15, "crispr": 16, "current": 22, "curs": 31, "d": 2, "dandelion": 1, "data": [1, 2, 3, 5, 7, 9, 10, 13, 15, 16, 17, 19, 20, 21, 23, 26, 27, 28, 34, 36, 37, 38, 39, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "databas": 4, "datafram": 19, "dataset": [2, 7, 11, 14, 16, 26, 38], "deconvolut": [17, 36], "deconvolv": 17, "decoupl": 15, "defin": [13, 25], "definit": [1, 9], "demo": 19, "descript": [26, 36], "design": [15, 19], "detect": [11, 16, 23, 34, 37, 46], "determin": 16, "develop": 49, "devic": [23, 24], "differ": [13, 23], "differenti": [5, 13, 14, 16, 25], "dimens": 40, "dimension": [31, 45], "direct": [17, 49, 51], "discret": 36, "discrimin": 16, "discuss": 23, "disk": 21, "distanc": 4, "distribut": [11, 33], "divers": 1, "doe": 30, "domain": 37, "doublet": [11, 23, 34, 46], "down": 50, "download": 49, "downstream": [10, 36], "droplet": 23, "dsb": 47, "dynam": 49, "each": 49, "earli": 7, "ecosystem": 21, "edger": 14, "effect": [13, 15], "effici": 19, "em": 51, "embed": [7, 27], "empti": 23, "end": 29, "endocrinogenesi": 51, "enrich": [11, 15], "environ": [5, 10, 14, 17, 25, 26, 27, 28, 34, 37, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "epitop": 4, "error": 23, "estim": 25, "evalu": [16, 28], "event": 49, "everi": 36, "evolv": 49, "examin": 49, "exampl": [19, 23], "execut": [3, 8], "expans": [1, 49], "experiment": [9, 15], "explor": [15, 16, 25], "express": [5, 14, 15, 36, 37, 38], "extract": 7, "factor": 28, "featur": [7, 8, 9, 11, 32], "figr": 8, "file": 21, "filter": [2, 11, 15, 34, 49], "first": 24, "fit": 36, "fluidigm": 24, "format": [2, 21, 30], "fragment": 11, "framework": 19, "from": [5, 21, 26, 38, 49], "fry": [15, 23], "full": [7, 23], "further": 36, "gamma": 33, "gather": 26, "gene": [1, 5, 7, 8, 14, 15, 16, 25, 26, 36, 37, 38, 41], "gener": [5, 24, 25, 26, 51], "genom": 23, "gex": 3, "glossari": 18, "glue": 27, "graph": [7, 27, 37], "grn": 26, "ground": 7, "group": 14, "gsea": 15, "h5ad": [8, 21], "ham": 4, "harmon": 7, "harmoni": 44, "hdf5": 21, "hierarch": 13, "histologi": 37, "histori": 24, "how": 7, "html": 8, "human": [6, 15, 50], "hyperparamet": 37, "hypothes": 15, "i": [7, 13, 41], "ident": 4, "identifi": [16, 40], "ifn": 16, "immun": 2, "import": 16, "imput": [27, 38], "index": 23, "infer": [8, 15, 25, 28, 49, 50, 51], "info": [15, 25, 27], "inform": [7, 21], "infrastructur": 20, "initi": 19, "inspect": 31, "instal": [8, 19], "intbc": 49, "integr": [3, 7, 27, 28, 37], "interact": [25, 40], "intercellular": 25, "interest": 25, "interoper": [1, 21], "interpret": [26, 49], "introduct": [4, 30], "ir": 2, "isol": 2, "j": 2, "javascript": 21, "julia": 21, "kang": 16, "kei": [25, 49], "knowledg": 25, "label": [7, 13], "languag": 21, "larg": 19, "layer": 19, "length": [7, 24], "level": [15, 19, 38], "liana": 25, "licens": 30, "life": 24, "ligand": 25, "limit": [16, 17, 25, 26], "limma": 15, "lineag": 49, "linear": [7, 16], "link": [23, 27], "load": [2, 5, 8, 10, 13, 17, 25, 44, 45, 46, 47, 48, 50, 51], "local": 16, "log": 47, "logarithm": 33, "loom": 21, "low": [15, 34, 49], "lower": 11, "lung": 49, "mani": 7, "manual": [4, 5, 43], "map": [5, 19, 23, 27, 29, 36, 38], "marker": [5, 12, 46], "marrow": [6, 50], "match": 4, "mathemat": 36, "matric": 19, "matrix": 23, "measur": [4, 39], "memori": 21, "metadata": 19, "method": [7, 19, 49], "metric": [4, 11, 28, 31], "microfluid": 24, "mnn": 7, "modal": [3, 12, 29], "model": [3, 7, 16, 25, 36, 49, 51], "mofa": 28, "moran": 41, "more": 36, "most": 16, "motif": 1, "motiv": [3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 21, 23, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "mous": 49, "mudata": [10, 19, 48], "multi": [28, 39], "multigr": 27, "multimod": [3, 19, 21], "multiom": 28, "multipl": 14, "multivi": 28, "muon": [10, 19], "music": 17, "mutual": 7, "mvtcr": 3, "nanopor": 24, "nearest": [7, 28], "need": 23, "neighbor": [7, 28], "neighborhood": 40, "neighbourhood": 13, "network": [8, 26], "neurip": 26, "new": [17, 21, 49, 51], "ng": 24, "nichenet": 25, "nomenclatur": 21, "normal": [15, 33, 47], "note": [7, 14, 15, 23, 24], "nuclei": 24, "nucleosom": 11, "null": 15, "number": [11, 15, 49], "object": [10, 19, 48], "observ": 19, "occurr": 40, "omic": 28, "onto": 27, "order": 50, "orient": 23, "osca": 22, "osta": 22, "other": 21, "out": [15, 49], "outcom": 26, "outlook": [25, 29, 50], "output": [3, 17, 25, 48], "overdispers": 33, "overlap": 27, "overview": [9, 19, 24, 39, 49], "own": 7, "packag": 8, "pair": 28, "pancreat": 51, "paramet": 51, "part": 38, "partial": [19, 27], "pathwai": 15, "pbmc": 15, "pca": [31, 45], "pearson": 33, "peer": 30, "per": 49, "perform": [11, 15], "perturb": 16, "phylogenet": 49, "pipelin": [23, 29, 49], "plastic": 49, "plate": 24, "plot": 38, "png": 8, "poisson": 33, "pool": 16, "potenti": 25, "practic": [22, 30, 36], "practis": 38, "pre": 36, "preced": 23, "predict": [4, 16, 25, 29], "prepar": [1, 3, 4, 7, 8, 14, 15, 23, 26, 27, 28, 49], "preprocess": [3, 16, 17, 37, 51], "prerank": 15, "prerequisit": 30, "prior": [22, 25], "priorit": 16, "process": [23, 24, 36], "product": 2, "profil": [2, 39], "properti": 49, "proteom": 29, "protocol": 24, "pseudo": 15, "pseudobulk": 14, "pseudotempor": 50, "pseudotim": 50, "public": 26, "python": [7, 21], "qc": [11, 48], "qualiti": [2, 11, 23, 31, 34, 48, 49], "quantif": [23, 24], "quantifi": 49, "queri": [4, 27], "quiz": [2, 3, 4, 7, 8, 13, 14, 15, 16, 25, 26], "r": [7, 17, 21], "ratio": 47, "raw": [2, 23], "rd": 21, "read": [10, 19, 21, 30, 39], "real": 23, "receiv": 25, "receptor": [2, 25], "recombin": 2, "recommend": 39, "reconstruct": 49, "reduct": [31, 45], "redund": 15, "refer": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "refin": 37, "region": 36, "regulatori": [8, 25, 26], "regulon": 26, "remark": 5, "remov": [7, 13], "repertoir": [1, 2], "represent": 23, "reproduc": 35, "residu": 33, "resolut": [23, 39], "resolv": 39, "resourc": 49, "respons": 16, "result": [8, 26], "retriev": 15, "review": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "rna": [3, 8, 12, 22, 24, 26, 27, 34, 51], "role": 2, "run": [3, 13, 15, 17], "rust": 21, "sampl": [15, 17, 48], "save": 8, "scalabl": 7, "scanpi": 19, "scenic": 26, "scgen": 16, "scib": 28, "score": [11, 15, 41], "screen": 16, "second": 24, "segment": 1, "select": [7, 32, 49], "sender": 25, "seq": [22, 28], "sequenc": [1, 2, 9, 23, 24], "session": [7, 15, 21, 25, 27], "set": [5, 15, 16, 25, 38, 51], "setup": [5, 10, 14, 15, 17, 25, 26, 27, 28, 34, 37, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "seurat": [10, 21, 27], "shift": 33, "should": 30, "signal": [11, 25], "signatur": 16, "silicon": 23, "simpl": 21, "simplifi": 23, "singl": [9, 14, 15, 16, 17, 19, 22, 24, 29, 30, 36, 38, 39], "singlecellexperi": 8, "size": 49, "sne": 31, "sourc": 25, "space": [38, 39], "spagcn": 37, "sparsiti": 9, "spatal": 36, "spatial": [36, 37, 38, 39, 40, 41], "spatiald": 41, "specif": [4, 14, 36], "spectratyp": 1, "splice": 23, "squidpi": [37, 41], "state": [2, 51], "statist": 49, "steadi": 51, "step": [23, 25], "stereoscop": 36, "stimul": [15, 16], "stop": 7, "store": 19, "stream": 50, "strict": 4, "structur": [13, 30], "studi": [15, 25], "sub": 39, "subset": 19, "summari": [24, 25], "system": 2, "t": [16, 31], "takeawai": [25, 49], "tangram": 38, "target": 25, "task": 50, "tcr": [1, 3, 4], "tcrdist": 4, "tcrmatch": 4, "technic": 15, "technologi": [38, 49], "tessa": 3, "test": [13, 15], "tf": 26, "theori": [8, 26], "thi": 30, "third": 24, "threshold": 11, "time": 49, "tissu": 36, "tool": [19, 49], "top": 25, "total": [11, 28], "totalvi": [27, 28], "trace": 49, "train": [7, 16, 38], "transcript": 24, "transcriptom": [3, 23, 24], "trap": 17, "tree": 49, "trimod": 27, "truth": 7, "tss": 11, "tumor": 49, "tutori": 22, "two": 15, "type": [7, 13, 15, 16, 23, 25, 36, 38, 46], "u": 30, "umap": [7, 31, 45], "umi": [7, 23], "uni": 3, "unifi": 27, "unimod": 19, "unintegr": 7, "unpair": 27, "unstructur": 19, "up": 16, "upper": 11, "us": [7, 8, 10, 15, 17, 19, 23, 26, 38], "usag": 1, "v": [2, 15, 24], "vae": 7, "valid": [17, 38], "variabl": [19, 41], "variat": [7, 16, 28], "variou": 4, "vdj": 2, "veloc": 51, "via": 4, "view": 19, "visual": [2, 8, 14, 16, 17, 25, 49], "voxel": 38, "warn": 5, "weight": 28, "were": 38, "what": [7, 13, 30], "who": 30, "whole": 17, "why": 13, "wider": 5, "wise": 48, "without": 13, "wnn": [27, 28], "workflow": 9, "world": 23, "write": [19, 21], "your": 7, "zellkonvert": 8, "\u03b2": 16}}) \ No newline at end of file +Search.setIndex({"alltitles": {"A Note on UMI Errors": [[23, null]], "A brief history of sequencing": [[24, "a-brief-history-of-sequencing"]], "A more mathematical description of deconvolution": [[36, "a-more-mathematical-description-of-deconvolution"]], "A note on alignment orientation": [[23, null]], "A note on preceding steps": [[23, null]], "A note on scalability": [[7, null]], "A note on sequencing length": [[24, null]], "A note on the redundancy between gene sets and the performance of preranked and fry gene set tests": [[15, "a-note-on-the-redundancy-between-gene-sets-and-the-performance-of-preranked-and-fry-gene-set-tests"]], "A real-world example": [[23, "a-real-world-example"]], "ADT": [[12, "adt"]], "AIR analysis on RNA clusters": [[3, "air-analysis-on-rna-clusters"]], "AIR repertoire analysis": [[2, "air-repertoire-analysis"]], "API overview": [[19, "api-overview"]], "ATAC": [[12, "atac"]], "Accessing Python from R": [[21, "accessing-python-from-r"]], "Accessing R from Python": [[21, "accessing-r-from-python"]], "Acknowledgements": [[0, null]], "Adding aligned metadata": [[19, "adding-aligned-metadata"]], "Advanced integration": [[27, null]], "Advanced: Multimodal data analysis with muon": [[19, "advanced-multimodal-data-analysis-with-muon"]], "Advanced: Using MuData to store multimodal data": [[19, "advanced-using-mudata-to-store-multimodal-data"]], "Alignment and mapping": [[23, "alignment-and-mapping"]], "Alternative formats": [[30, "alternative-formats"]], "Analysing single-pooled CRISPR screens": [[16, "analysing-single-pooled-crispr-screens"]], "Analysis frameworks and tools": [[19, null]], "Analytic Pearson residuals": [[33, "analytic-pearson-residuals"]], "Annotation": [[5, null], [43, null]], "Annotation by mapping to a reference": [[5, "annotation-by-mapping-to-a-reference"]], "Approaches": [[17, "approaches"], [25, "approaches"]], "Assigning AIR State": [[2, "assigning-air-state"]], "Assumptions & Limitations": [[25, "assumptions-limitations"]], "Atlas building and reference mapping": [[29, "atlas-building-and-reference-mapping"]], "Augur model": [[16, null]], "Authors": [[5, "authors"], [6, "authors"], [7, "authors"], [8, "authors"], [9, "authors"], [11, "authors"], [13, "authors"], [14, "authors"], [15, "authors"], [16, "authors"], [17, "authors"], [19, "authors"], [21, "authors"], [23, "authors"], [24, "authors"], [26, "authors"], [27, "authors"], [28, "authors"], [31, "authors"], [32, "authors"], [33, "authors"], [34, "authors"], [36, "authors"], [37, "authors"], [38, "authors"], [39, "authors"], [40, "authors"], [41, "authors"], [43, "authors"], [44, "authors"], [45, "authors"], [46, "authors"], [47, "authors"], [48, "authors"], [49, "authors"], [50, "authors"]], "Authors:": [[25, "authors"]], "Automated annotation": [[5, "automated-annotation"], [43, "automated-annotation"]], "BCR Data Analysis with Dandelion": [[1, "bcr-data-analysis-with-dandelion"]], "BCR specificity analysis": [[4, "bcr-specificity-analysis"]], "Background": [[17, "background"]], "Batch correction": [[44, null]], "Batch removal complexity": [[7, "batch-removal-complexity"]], "Batch-aware feature selection": [[7, "batch-aware-feature-selection"]], "Benchmarking": [[29, "benchmarking"]], "Benchmarking your own integration": [[7, "benchmarking-your-own-integration"]], "Benisse": [[3, "benisse"]], "Bioconductor": [[21, "bioconductor"]], "Bioconductor OSCA and OSTA books": [[22, "bioconductor-osca-and-osta-books"]], "Brief discussion": [[23, "brief-discussion"]], "Building the index": [[23, "building-the-index"]], "Building the model": [[7, "building-the-model"]], "Building the reference": [[27, "building-the-reference"]], "Bulk deconvolution": [[17, null]], "CITE-seq data": [[28, "cite-seq-data"]], "Calculate a batch-corrected UMAP": [[7, "calculate-a-batch-corrected-umap"]], "Calculate and visualize tumors\u2019 statistics": [[49, "calculate-and-visualize-tumors-statistics"]], "Calculating QC metrics": [[11, "calculating-qc-metrics"]], "Calculating local perturbation signatures": [[16, "calculating-local-perturbation-signatures"]], "Case Study": [[25, "case-study"]], "Case study: Pathway enrichment analysis and activity level scoring in human PBMC single cells": [[15, "case-study-pathway-enrichment-analysis-and-activity-level-scoring-in-human-pbmc-single-cells"]], "Cassiopeia for lineage tracing analysis": [[49, "cassiopeia-for-lineage-tracing-analysis"]], "Cell barcode correction": [[23, "cell-barcode-correction"]], "Cell isolation": [[2, "cell-isolation"]], "Cell-Aligned Data": [[2, "cell-aligned-data"]], "Cell-cell communication": [[25, null]], "Cell-level pathway activity scoring using AUCell": [[15, "cell-level-pathway-activity-scoring-using-aucell"]], "Cell-type specific expression of every gene in the spatial data": [[36, "cell-type-specific-expression-of-every-gene-in-the-spatial-data"]], "Cell2Location cell type mapping": [[36, "cell2location-cell-type-mapping"]], "Cell2Location in practice": [[36, "cell2location-in-practice"]], "Cell2location": [[36, "cell2location"]], "Centered Log-Ratio normalization": [[47, "centered-log-ratio-normalization"]], "Choosing an integration method": [[7, "choosing-an-integration-method"]], "Citation": [[30, "citation"]], "Classifiers based on a wider set of genes": [[5, "classifiers-based-on-a-wider-set-of-genes"]], "Clonal expansion": [[1, "clonal-expansion"]], "Clonal expansion: diversity and abundance": [[1, "clonal-expansion-diversity-and-abundance"]], "Clonotype abundance": [[1, "clonotype-abundance"]], "Clonotype analysis": [[1, null]], "Clonotype definition": [[1, "clonotype-definition"], [1, "id13"]], "Cluster-level gene set enrichment analysis with decoupler": [[15, "cluster-level-gene-set-enrichment-analysis-with-decoupler"]], "Clustering": [[6, null]], "Clustering human bone marrow cells": [[6, "clustering-human-bone-marrow-cells"]], "Co-occurrence across spatial dimensions": [[40, "co-occurrence-across-spatial-dimensions"]], "CoNGA": [[3, "conga"]], "Collecting cellranger outputs into MuData object": [[48, "collecting-cellranger-outputs-into-mudata-object"]], "Combining NicheNet output with ligand-receptor inference": [[25, "combining-nichenet-output-with-ligand-receptor-inference"]], "Common gene set between reference and spatial dataset": [[38, "common-gene-set-between-reference-and-spatial-dataset"]], "Common observations": [[19, "common-observations"]], "Comparisons of data integration methods": [[7, "comparisons-of-data-integration-methods"]], "Compositional analysis": [[13, null]], "Computational tools to interpret time-course lineage tracing data": [[49, "computational-tools-to-interpret-time-course-lineage-tracing-data"]], "Computing the map from single-cells to spatial voxels": [[38, "computing-the-map-from-single-cells-to-spatial-voxels"]], "Conclusions": [[49, "conclusions"]], "Configure data": [[27, "configure-data"]], "Constructing a map between technologies": [[38, "constructing-a-map-between-technologies"]], "Contact us": [[30, "contact-us"]], "Contributing": [[30, "contributing"]], "Contributions": [[25, "contributions"]], "Contributors": [[5, "contributors"], [6, "contributors"], [7, "contributors"], [8, "contributors"], [9, "contributors"], [11, "contributors"], [13, "contributors"], [14, "contributors"], [15, "contributors"], [16, "contributors"], [17, "contributors"], [19, "contributors"], [21, "contributors"], [23, "contributors"], [24, "contributors"], [26, "contributors"], [27, "contributors"], [28, "contributors"], [31, "contributors"], [32, "contributors"], [33, "contributors"], [34, "contributors"], [36, "contributors"], [37, "contributors"], [38, "contributors"], [39, "contributors"], [40, "contributors"], [41, "contributors"], [43, "contributors"], [44, "contributors"], [45, "contributors"], [46, "contributors"], [47, "contributors"], [48, "contributors"], [49, "contributors"], [50, "contributors"]], "Conversion of muon objects to Seurat objects to use in downstream analysis": [[10, null]], "Conversion to DataFrames": [[19, "conversion-to-dataframes"]], "Convert Seurat assay to chromatin assay": [[10, "convert-seurat-assay-to-chromatin-assay"]], "Correction of ambient RNA": [[34, "correction-of-ambient-rna"]], "Count cells in neighbourhoods": [[13, "count-cells-in-neighbourhoods"]], "Count data representation": [[23, "count-data-representation"]], "Count distribution-based doublet scoring": [[11, "count-distribution-based-doublet-scoring"]], "Count matrix quality control": [[23, "count-matrix-quality-control"]], "Coverage-based doublet scoring": [[11, "coverage-based-doublet-scoring"]], "Create pseudo-bulk samples and explore the data": [[15, "create-pseudo-bulk-samples-and-explore-the-data"]], "Current best practices in single-cell RNA-seq analysis: a tutorial": [[22, "current-best-practices-in-single-cell-rna-seq-analysis-a-tutorial"]], "Curse of dimensionality": [[31, null]], "DSB normalization": [[47, "dsb-normalization"]], "Dandelion interoperability": [[1, "dandelion-interoperability"]], "Data Preparation": [[3, "data-preparation"], [3, "id7"]], "Data Preprocessing": [[3, "data-preprocessing"]], "Data characteristics - feature definition and sparsity": [[9, "data-characteristics-feature-definition-and-sparsity"]], "Data exploration": [[16, "data-exploration"]], "Data infrastructure": [[20, null]], "Data integration": [[7, null]], "Data loading": [[13, "data-loading"], [50, "data-loading"], [51, "data-loading"]], "Data normalization": [[15, "data-normalization"]], "Data preparation": [[7, "data-preparation"]], "Data preprocessing": [[17, "data-preprocessing"], [51, "data-preprocessing"]], "Database Preparation": [[4, "database-preparation"]], "Database Queries": [[4, "database-queries"], [4, "id13"]], "Database query via distance metrics": [[4, "database-query-via-distance-metrics"]], "Dataset": [[2, "dataset"], [7, "dataset"], [11, "dataset"]], "Dataset description": [[26, "dataset-description"]], "Deconvolving bulk COVID-19 whole blood samples": [[17, "deconvolving-bulk-covid-19-whole-blood-samples"]], "Deconvolving using MuSiC": [[17, "deconvolving-using-music"]], "Define neighbourhoods": [[13, "define-neighbourhoods"]], "Determining the most important genes for the prioritization": [[16, "determining-the-most-important-genes-for-the-prioritization"]], "Differential gene expression analysis": [[14, null]], "Differential prioritization": [[16, "differential-prioritization"]], "Dimensionality Reduction": [[31, null], [45, null]], "Discrete tissue regions": [[36, "discrete-tissue-regions"]], "Disk-based interoperability": [[21, "disk-based-interoperability"]], "Distance Measurements": [[4, "distance-measurements"]], "Distances": [[4, "distances"]], "Doublet Detection": [[34, "doublet-detection"]], "Doublet detection": [[11, "doublet-detection"], [23, "doublet-detection"], [46, null]], "Doublets detected with cell type markers": [[46, "doublets-detected-with-cell-type-markers"]], "Down-stream tasks and outlook": [[50, "down-stream-tasks-and-outlook"]], "Downloading the data": [[49, "downloading-the-data"]], "Downstream analysis": [[36, "downstream-analysis"]], "Early stopping": [[7, null]], "Efficient data access": [[19, "efficient-data-access"]], "Empty droplet detection": [[23, "empty-droplet-detection"]], "End-to-end pipelines": [[29, "end-to-end-pipelines"]], "Environment setup": [[5, "environment-setup"], [10, "environment-setup"], [14, "environment-setup"], [17, "environment-setup"], [25, "environment-setup"], [26, "environment-setup"], [27, "environment-setup"], [28, "environment-setup"], [44, "environment-setup"], [45, "environment-setup"], [46, "environment-setup"], [47, "environment-setup"], [50, "environment-setup"], [51, "environment-setup"]], "Environment setup and data": [[34, "environment-setup-and-data"], [37, "environment-setup-and-data"], [40, "environment-setup-and-data"], [41, "environment-setup-and-data"], [48, "environment-setup-and-data"]], "Environment setup.": [[49, "environment-setup"]], "Epitope Prediction": [[4, "epitope-prediction"]], "Evaluating the predicted IFN-\u03b2 response": [[16, "evaluating-the-predicted-ifn-response"]], "Examine the data": [[49, "examine-the-data"]], "Executing CoNGA": [[3, "executing-conga"]], "Experimental assay": [[9, "experimental-assay"]], "Extracting the embedding": [[7, "extracting-the-embedding"]], "Feature selection": [[32, null]], "FigR": [[8, "figr"]], "Filtering": [[2, "filtering"]], "Filtering cells": [[11, "filtering-cells"]], "Filtering features": [[11, "filtering-features"]], "Filtering low quality cells": [[34, "filtering-low-quality-cells"]], "Filtering out low-quality tumors": [[49, "filtering-out-low-quality-tumors"]], "Filtering out the gene sets with low number of genes": [[15, "filtering-out-the-gene-sets-with-low-number-of-genes"]], "First-generation sequencing": [[24, "first-generation-sequencing"]], "Fitting the reference model": [[36, "fitting-the-reference-model"]], "Fluidigm C1": [[24, "fluidigm-c1"]], "Formation of adaptive immune receptors by V(D)J recombination": [[2, "formation-of-adaptive-immune-receptors-by-v-d-j-recombination"]], "From cluster differentially expressed genes to cluster annotation": [[5, "from-cluster-differentially-expressed-genes-to-cluster-annotation"]], "From markers to cluster annotation": [[5, "from-markers-to-cluster-annotation"]], "Further Models in Reference Based Deconvolution": [[36, "further-models-in-reference-based-deconvolution"]], "GEX analysis on AIR clusters": [[3, "gex-analysis-on-air-clusters"]], "Gamma-Poisson distribution": [[33, null]], "Gathering TF regulons from public data": [[26, "gathering-tf-regulons-from-public-data"]], "Gene regulatory network inference using RNA and ATAC features": [[8, "gene-regulatory-network-inference-using-rna-and-atac-features"]], "Gene regulatory networks": [[26, null]], "Gene regulatory networks using chromatin accessibility": [[8, null]], "Gene segment usage": [[1, "gene-segment-usage"]], "Gene segment usage and spectratype": [[1, "gene-segment-usage-and-spectratype"]], "Gene set enrichment and pathway analysis": [[15, null]], "Gene set enrichment for complex experimental designs using limma-fry and pseudo-bulks": [[15, "gene-set-enrichment-for-complex-experimental-designs-using-limma-fry-and-pseudo-bulks"]], "Gene set test vs. pathway activity inference": [[15, "gene-set-test-vs-pathway-activity-inference"]], "Gene set tests and pathway analysis": [[15, "gene-set-tests-and-pathway-analysis"]], "Gene usage": [[1, "gene-usage"]], "General remarks": [[5, "general-remarks"]], "General settings": [[51, "general-settings"]], "Generating a Ligand-Receptor consensus with LIANA": [[25, "generating-a-ligand-receptor-consensus-with-liana"]], "Generation of GRNs using RNA data": [[26, "generation-of-grns-using-rna-data"]], "Glossary": [[18, null]], "Graph construction": [[27, "graph-construction"]], "Graph-based integration": [[7, "graph-based-integration"]], "H5AD": [[21, "h5ad"]], "HDF5-based formats": [[21, "hdf5-based-formats"]], "Harmony": [[44, "harmony"]], "How many genes to use?": [[7, null]], "Hyperparameters of SpaGCN": [[37, "hyperparameters-of-spagcn"]], "IRs of the adaptive immune system": [[2, "irs-of-the-adaptive-immune-system"]], "Identical matches": [[4, "identical-matches"]], "Identifying cells with no detectable perturbation": [[16, "identifying-cells-with-no-detectable-perturbation"]], "Identifying interactions between spatial communities": [[40, "identifying-interactions-between-spatial-communities"]], "Identifying the cell types most affected by perturbations": [[16, "conditions-perturbation-modeling-key-takeaway-1"]], "Immune Receptor Profiling": [[2, null]], "Immune receptor sequencing": [[2, "immune-receptor-sequencing"]], "Imputation": [[38, null]], "Imputing genes and mapping cell-types to space": [[38, "imputing-genes-and-mapping-cell-types-to-space"]], "In-memory interoperability": [[21, "in-memory-interoperability"]], "Inferring expansion events": [[49, "inferring-expansion-events"]], "Inferring pseudotime for adult human bone marrow": [[50, "inferring-pseudotime-for-adult-human-bone-marrow"]], "Inferring tree plasticity": [[49, "inferring-tree-plasticity"]], "Initializing a MuData object": [[19, "initializing-a-mudata-object"]], "Initializing an AnnData object": [[19, "initializing-an-anndata-object"]], "Inspecting quality control metrics": [[31, "inspecting-quality-control-metrics"]], "Install and load FigR package": [[8, "install-and-load-figr-package"]], "Installation": [[19, "installation"], [19, "id12"], [19, "id18"], [19, "id20"]], "Integrate gene expression and histology into a Graph": [[37, "integrate-gene-expression-and-histology-into-a-graph"]], "Integrating AIR and transcriptomics": [[3, null]], "Integrating BCR and GEX": [[3, "integrating-bcr-and-gex"]], "Integrating TCR and GEX": [[3, "integrating-tcr-and-gex"]], "Integrating UMI and full-length data": [[7, null]], "Integration with partially overlapping data and query-to-reference mapping with totalVI": [[27, "integration-with-partially-overlapping-data-and-query-to-reference-mapping-with-totalvi"]], "Interoperability": [[21, null]], "Interoperability between R ecosystems": [[21, "interoperability-between-r-ecosystems"]], "Interoperability for multimodal data": [[21, "interoperability-for-multimodal-data"]], "Interoperability with other languages": [[21, "interoperability-with-other-languages"]], "Interpretation of results": [[26, "interpretation-of-results"]], "Introduction": [[4, "introduction"], [30, "introduction"]], "JavaScript": [[21, "javascript"]], "Julia": [[21, "julia"]], "Key takeaways": [[25, "key-takeaways"], [49, "key-takeaways"]], "Label harmonization": [[7, null]], "Layers": [[19, "layers"]], "License": [[30, "license"]], "Ligand-receptor inference": [[25, "ligand-receptor-inference"]], "Limitations and traps": [[17, "limitations-and-traps"]], "Limitations of Augur": [[16, "limitations-of-augur"]], "Limitations of TF regulons": [[26, "limitations-of-tf-regulons"]], "Lineage tracing": [[49, null]], "Lineage tracing technologies": [[49, "lineage-tracing-technologies"]], "Linear embedding integration using Mutual Nearest Neighbors (MNN)": [[7, "linear-embedding-integration-using-mutual-nearest-neighbors-mnn"]], "Load NicheNet Prior-Knowledge": [[25, "load-nichenet-prior-knowledge"]], "Load data": [[2, "load-data"], [5, "load-data"], [10, "load-data"]], "Loading Data": [[17, "loading-data"]], "Loading R": [[17, "loading-r"]], "Loading the complete MuData object": [[48, "loading-the-complete-mudata-object"]], "Loading the data": [[44, "loading-the-data"], [45, "loading-the-data"], [46, "loading-the-data"], [47, "loading-the-data"]], "Loom": [[21, "loom"]], "Lower bound QC thresholds": [[11, "lower-bound-qc-thresholds"]], "Manual Query": [[4, "manual-query"]], "Manual annotation": [[5, "manual-annotation"], [43, "manual-annotation"]], "Mapping ADT onto an RNA atlas with bridge integration": [[27, "mapping-adt-onto-an-rna-atlas-with-bridge-integration"]], "Mapping against different reference sequences": [[23, "mapping-against-different-reference-sequences"]], "Mapping and quantification": [[23, "mapping-and-quantification"]], "Mapping to an augmented transcriptome": [[23, "mapping-to-an-augmented-transcriptome"]], "Mapping to the full genome": [[23, "mapping-to-the-full-genome"]], "Mapping to the spliced transcriptome": [[23, "mapping-to-the-spliced-transcriptome"]], "Marker gene-based classifiers": [[5, "marker-gene-based-classifiers"]], "Markers for cluster annotations across modalities": [[12, null]], "Microfluidic device-based protocols": [[24, "microfluidic-device-based-protocols"]], "Modality prediction": [[29, "modality-prediction"]], "Model construction and training": [[16, "model-construction-and-training"]], "Modeling RNA velocity": [[51, "modeling-rna-velocity"]], "Modelling differential intercellular signalling with NicheNet": [[25, "modelling-differential-intercellular-signalling-with-nichenet"]], "Moran\u2019s I score in Squidpy": [[41, "moran-s-i-score-in-squidpy"]], "Motif sequence analysis": [[1, "motif-sequence-analysis"], [1, "id23"]], "Motivation": [[3, "motivation"], [5, "motivation"], [6, "motivation"], [7, "motivation"], [8, "motivation"], [9, "motivation"], [11, "motivation"], [13, "motivation"], [14, "motivation"], [15, "motivation"], [16, "motivation"], [16, "id10"], [21, "motivation"], [23, "motivation"], [25, "motivation"], [26, "motivation"], [27, "motivation"], [28, "motivation"], [32, "motivation"], [33, "motivation"], [34, "motivation"], [36, "motivation"], [37, "motivation"], [38, "motivation"], [39, "motivation"], [40, "motivation"], [41, "motivation"], [43, "motivation"], [44, "motivation"], [45, "motivation"], [46, "motivation"], [47, "motivation"], [48, "motivation"], [49, "motivation"], [50, "motivation"], [51, "motivation"]], "MuData attributes": [[19, "mudata-attributes"]], "MuData views": [[19, "mudata-views"]], "Multi-Omics Factor Analysis (MOFA+)": [[28, "multi-omics-factor-analysis-mofa"]], "Multi-cell resolution": [[39, "multi-cell-resolution"]], "MultiVI": [[28, "multivi"]], "Multimodal Integration": [[3, "multimodal-integration"]], "Multimodal methods": [[19, "multimodal-methods"]], "Multiome data": [[28, "multiome-data"]], "Multiple groups": [[14, "multiple-groups"]], "Nanopore single-cell transcriptome sequencing": [[24, "nanopore-single-cell-transcriptome-sequencing"]], "Neighborhood analysis": [[40, null]], "New directions": [[17, "new-directions"], [49, "new-directions"], [51, "new-directions"]], "New on-disk formats": [[21, "new-on-disk-formats"]], "New phylogenetic inference algorithms": [[49, "new-phylogenetic-inference-algorithms"]], "Nomenclature": [[21, "nomenclature"]], "Normalization": [[33, null], [47, null]], "Note on using an Apple silicon-based device": [[23, null]], "Notes on edgeR": [[14, "notes-on-edger"]], "Nucleosome signal": [[11, "nucleosome-signal"]], "Null hypotheses in gene set enrichment analysis": [[15, "null-hypotheses-in-gene-set-enrichment-analysis"]], "Number of intBCs per Tumor": [[49, "number-of-intbcs-per-tumor"]], "Observation/variable-level matrices": [[19, "observation-variable-level-matrices"]], "Observational or Variable level": [[19, "observational-or-variable-level"]], "On the effect of filtering low-expression genes": [[15, "on-the-effect-of-filtering-low-expression-genes"]], "One group": [[14, "one-group"], [14, "id21"]], "Outcome of the analysis": [[26, "outcome-of-the-analysis"]], "Outlook": [[29, null]], "Output": [[3, "output"], [3, "id8"], [3, "id14"]], "Outputs and Validations": [[17, "outputs-and-validations"]], "Overdispersion": [[33, null]], "Overview": [[24, "overview"]], "Overview of evolving lineage tracing data analysis pipelines": [[49, "overview-of-evolving-lineage-tracing-data-analysis-pipelines"]], "Overview of spatial profiling measurements": [[39, "overview-of-spatial-profiling-measurements"]], "Overview of the NGS process": [[24, "overview-of-the-ngs-process"]], "Overview of the data analysis workflow": [[9, "overview-of-the-data-analysis-workflow"]], "PCA": [[31, "pca"]], "PCA and UMAP": [[45, "pca-and-umap"]], "Paired integration": [[28, null]], "Parameter inference": [[51, "parameter-inference"]], "Partial reading of large data": [[19, "partial-reading-of-large-data"]], "Pathway and gene set collections": [[15, "pathway-and-gene-set-collections"]], "Peer-review": [[30, "peer-review"]], "Perform filtering": [[11, "perform-filtering"]], "Perturbation modeling": [[16, null]], "Plate-based protocols": [[24, "plate-based-protocols"]], "Plotting genes that were not part of the training data": [[38, "plotting-genes-that-were-not-part-of-the-training-data"]], "Pre-processing of the spatal and single-cell data": [[36, "pre-processing-of-the-spatal-and-single-cell-data"]], "Predicting CD4T responses to IFN-\u03b2 stimulation": [[16, "predicting-cd4t-responses-to-ifn-stimulation"]], "Predicting IFN-\u03b2 response for CD4-T cells": [[16, "predicting-ifn-response-for-cd4-t-cells"]], "Predicting cell type prioritization for IFN-\u03b2 stimulation": [[16, "predicting-cell-type-prioritization-for-ifn-stimulation"]], "Prediction": [[4, "prediction"]], "Preparation": [[23, "preparation"]], "Preparation and execution of cisTopic": [[8, "preparation-and-execution-of-cistopic"]], "Preparation of SCENIC": [[26, "preparation-of-scenic"]], "Preparation of the NeurIPs dataset": [[26, "preparation-of-the-neurips-dataset"]], "Prepare and explore the data": [[15, "prepare-and-explore-the-data"]], "Prepare data": [[27, "prepare-data"], [28, "prepare-data"], [28, "id9"]], "Preparing the data for lineage reconstruction": [[49, "preparing-the-data-for-lineage-reconstruction"]], "Preparing the dataset": [[14, "preparing-the-dataset"]], "Preprocessing": [[16, "preprocessing"]], "Preprocessing of gene expression data": [[37, "preprocessing-of-gene-expression-data"]], "Prerequisites": [[30, "prerequisites"]], "Prior art": [[22, null]], "Productive AIRs": [[2, "productive-airs"]], "Pseudobulk": [[14, "pseudobulk"]], "Pseudotemporal ordering": [[50, null]], "Pseudotime construction": [[50, "pseudotime-construction"], [50, "id32"]], "Python": [[7, "python"], [21, "python"], [21, "id1"]], "Quality Control": [[2, "quality-control"], [11, null], [34, null], [48, "id13"]], "Quality control": [[48, null]], "Quantification": [[23, "quantification"]], "Quantifying dynamic properties from the tree": [[49, "quantifying-dynamic-properties-from-the-tree"]], "Query mapping and imputation with Seurat\u2019s WNN": [[27, "query-mapping-and-imputation-with-seurat-s-wnn"]], "Query via Hamming Distance": [[4, "query-via-hamming-distance"]], "Query with various Strictness": [[4, "query-with-various-strictness"]], "Query-to-reference mapping": [[27, "query-to-reference-mapping"]], "Querying the trimodal reference": [[27, "querying-the-trimodal-reference"]], "Quiz": [[2, "quiz"], [3, "quiz"], [4, "quiz"], [7, "quiz"], [8, "quiz"], [13, "quiz"], [14, "quiz"], [15, "quiz"], [16, "quiz"], [25, "quiz"], [26, "quiz"]], "R": [[7, "r"], [21, "r"], [21, "id2"]], "RDS files": [[21, "rds-files"]], "RNA": [[12, "rna"]], "RNA sequencing": [[24, "rna-sequencing"]], "RNA velocity": [[51, null]], "RNA velocity inference - EM model": [[51, "rna-velocity-inference-em-model"]], "RNA velocity inference - Steady-state model": [[51, "rna-velocity-inference-steady-state-model"]], "RNA velocity inference in pancreatic endocrinogenesis": [[51, "rna-velocity-inference-in-pancreatic-endocrinogenesis"]], "Raw data": [[2, "raw-data"]], "Raw data processing": [[23, null]], "Raw data quality control": [[23, "raw-data-quality-control"]], "Read in mudata object": [[10, "read-in-mudata-object"]], "Reading and Writing of MuData objects": [[19, "reading-and-writing-of-mudata-objects"]], "Reading and writing of AnnData objects": [[19, "reading-and-writing-of-anndata-objects"]], "Reading/writing H5AD with Bioconductor": [[21, "reading-writing-h5ad-with-bioconductor"]], "Reading/writing H5AD with {Seurat}": [[21, "reading-writing-h5ad-with-seurat"]], "Reading/writing H5AD with {anndata}": [[21, "reading-writing-h5ad-with-anndata"]], "Recommended reading": [[39, "recommended-reading"]], "Reconstructing the lineage": [[49, "reconstructing-the-lineage"]], "Reconstruction of a selected tumor (3726_NT_T1)": [[49, "reconstruction-of-a-selected-tumor-3726-nt-t1"]], "References": [[1, "references"], [2, "references"], [3, "references"], [4, "references"], [5, "references"], [6, "references"], [7, "references"], [8, "references"], [9, "references"], [11, "references"], [13, "references"], [14, "references"], [15, "references"], [16, "references"], [17, "references"], [19, "references"], [21, "references"], [22, "references"], [23, "references"], [24, "references"], [25, "references"], [26, "references"], [27, "references"], [28, "references"], [29, "references"], [30, "references"], [31, "references"], [32, "references"], [33, "references"], [34, "references"], [36, "references"], [37, "references"], [38, "references"], [39, "references"], [40, "references"], [41, "references"], [43, "references"], [44, "references"], [45, "references"], [46, "references"], [47, "references"], [48, "references"], [49, "references"], [50, "references"], [51, "references"]], "Refining the detected spatial domains": [[37, "refining-the-detected-spatial-domains"]], "Repertoire comparison": [[1, "repertoire-comparison"]], "Reproducibility": [[35, null]], "Resources for developing new computational methods": [[49, "resources-for-developing-new-computational-methods"]], "Results visualization": [[8, "results-visualization"]], "Retrieving gene sets": [[15, "retrieving-gene-sets"]], "Reviewers": [[5, "reviewers"], [6, "reviewers"], [7, "reviewers"], [8, "reviewers"], [9, "reviewers"], [11, "reviewers"], [13, "reviewers"], [14, "reviewers"], [15, "reviewers"], [16, "reviewers"], [19, "reviewers"], [21, "reviewers"], [23, "reviewers"], [24, "reviewers"], [26, "reviewers"], [27, "reviewers"], [28, "reviewers"], [31, "reviewers"], [32, "reviewers"], [33, "reviewers"], [34, "reviewers"], [36, "reviewers"], [37, "reviewers"], [38, "reviewers"], [39, "reviewers"], [40, "reviewers"], [41, "reviewers"], [43, "reviewers"], [44, "reviewers"], [45, "reviewers"], [46, "reviewers"], [47, "reviewers"], [48, "reviewers"], [49, "reviewers"], [50, "reviewers"]], "Reviewers:": [[25, "reviewers"]], "Role IR in cells": [[2, "role-ir-in-cells"]], "Run differential abundance test on neighbourhoods": [[13, "run-differential-abundance-test-on-neighbourhoods"]], "Running GSEA": [[15, "running-gsea"]], "Running MuSiC": [[17, "running-music"]], "Running the model": [[3, "running-the-model"], [3, "id13"]], "Rust": [[21, "rust"]], "SCENIC": [[26, "scenic"]], "Sample-wise QC": [[48, "sample-wise-qc"]], "Save network as HTML/PNG": [[8, "save-network-as-html-png"]], "Scanpy API design": [[19, "scanpy-api-design"]], "Scanpy example": [[19, "scanpy-example"]], "Second-generation sequencing": [[24, "second-generation-sequencing"]], "Session Info": [[25, "session-info"]], "Session info": [[15, "session-info"], [27, "session-info"]], "Session information": [[7, "session-information"], [21, "session-information"]], "Setting up the Kang dataset for scGen": [[16, "setting-up-the-kang-dataset-for-scgen"]], "Setup for limma and fry": [[15, "setup-for-limma-and-fry"]], "Seurat": [[21, "seurat"]], "Shifted logarithm": [[33, "shifted-logarithm"]], "Simple formats": [[21, "simple-formats"]], "Simplified raw data processing pipeline": [[23, "simplified-raw-data-processing-pipeline"]], "Single-cell ATAC sequencing": [[9, null]], "Single-cell RNA sequencing": [[24, null], [24, "introduction-scrna-seq-key-takeaway-2"]], "Single-cell analysis frameworks and consortia": [[19, "single-cell-analysis-frameworks-and-consortia"]], "Single-cell best practices": [[30, null]], "Single-cell data resolved in space": [[39, null]], "Single-cell proteomics": [[29, "single-cell-proteomics"]], "Single-cell resolution": [[39, "single-cell-resolution"]], "Single-cell sequencing protocols": [[24, "single-cell-sequencing-protocols"]], "Single-cell specific": [[14, "single-cell-specific"]], "Single-cell vs single-nuclei": [[24, "single-cell-vs-single-nuclei"]], "Size of each tumor": [[49, "size-of-each-tumor"]], "SpaGCN": [[37, "spagcn"]], "Spatial deconvolution": [[36, null]], "Spatial domains": [[37, null]], "Spatial domains in Squidpy": [[37, "spatial-domains-in-squidpy"]], "SpatialDE": [[41, "spatialde"]], "Spatially variable genes": [[41, null]], "Specificity analysis": [[4, null]], "Spectratype": [[1, "spectratype"]], "Spectratype analysis": [[1, "spectratype-analysis"]], "Step 1. Define cell types of interest to be considered as senders/sources and receiver/targets of CCC interactions": [[25, "step-1-define-cell-types-of-interest-to-be-considered-as-senders-sources-and-receiver-targets-of-ccc-interactions"]], "Step 2. Define a set of ligands that can potentially affect receiver cell types": [[25, "step-2-define-a-set-of-ligands-that-can-potentially-affect-receiver-cell-types"]], "Step 3. Define a gene set of interest in receiver cell type(s)": [[25, "step-3-define-a-gene-set-of-interest-in-receiver-cell-type-s"]], "Step 4. NicheNet ligand activity estimation": [[25, "step-4-nichenet-ligand-activity-estimation"]], "Step 5. Infer & Visualize top-predicted target genes for top ligands": [[25, "step-5-infer-visualize-top-predicted-target-genes-for-top-ligands"]], "Stereoscope": [[36, "stereoscope"]], "Storing unimodal data with AnnData": [[19, "storing-unimodal-data-with-anndata"]], "Structure of the book": [[30, "structure-of-the-book"]], "Sub-cellular resolution": [[39, "sub-cellular-resolution"]], "Subsetting using metadata": [[19, "subsetting-using-metadata"]], "Summary": [[24, "summary"]], "Summary & Outlook:": [[25, "summary-outlook"]], "TCR data preparation": [[1, "tcr-data-preparation"]], "TCR specificity analysis": [[4, "tcr-specificity-analysis"]], "TCRdist": [[4, "tcrdist"]], "TCRmatch": [[4, "tcrmatch"]], "TESSA": [[3, "tessa"]], "TSS enrichment": [[11, "tss-enrichment"]], "Technical considerations": [[15, "technical-considerations"]], "The EM model": [[51, "the-em-model"]], "The building block of life": [[24, "the-building-block-of-life"]], "The complete alevin-fry pipeline": [[23, "the-complete-alevin-fry-pipeline"]], "The need for UMI resolution": [[23, "the-need-for-umi-resolution"]], "The steady-state model": [[51, "the-steady-state-model"]], "Theory": [[8, "theory"], [26, "theory"]], "Third-generation sequencing": [[24, "third-generation-sequencing"]], "Total Variational Inference (totalVI)": [[28, "total-variational-inference-totalvi"]], "Total fragment count and number of features": [[11, "total-fragment-count-and-number-of-features"]], "Tracing tumor development in a mouse model of lung cancer": [[49, "tracing-tumor-development-in-a-mouse-model-of-lung-cancer"]], "Training the model": [[7, "training-the-model"]], "Transcript quantification": [[24, "transcript-quantification"]], "Trimodal integration and query-to-reference mapping with multigrate": [[27, "trimodal-integration-and-query-to-reference-mapping-with-multigrate"]], "Type of errors in barcoding": [[23, "type-of-errors-in-barcoding"]], "Types of integration models": [[7, "types-of-integration-models"]], "Types of mapping": [[23, "types-of-mapping"]], "UMAP": [[31, "umap"]], "UMI resolution": [[23, "umi-resolution"]], "Uni-modal Analysis with multimodal conditions": [[3, "uni-modal-analysis-with-multimodal-conditions"]], "Unimodal data analysis with scanpy": [[19, "unimodal-data-analysis-with-scanpy"]], "Unintegrated data": [[7, "unintegrated-data"]], "Unpaired integration with Graph Linked Unified Embedding (GLUE)": [[27, "unpaired-integration-with-graph-linked-unified-embedding-glue"]], "Unstructured metadata": [[19, "unstructured-metadata"]], "Upper bound QC thresholds": [[11, "upper-bound-qc-thresholds"]], "Use zellkonverter to convert h5ad to SingleCellExperiment": [[8, "use-zellkonverter-to-convert-h5ad-to-singlecellexperiment"]], "Useful links": [[23, "useful-links"]], "Using Tangram in practise": [[38, "using-tangram-in-practise"]], "VAE integration using cell labels": [[7, "vae-integration-using-cell-labels"]], "VDJ-sequencing": [[2, "vdj-sequencing"]], "Validation on expression level": [[38, "validation-on-expression-level"]], "Variable mappings": [[19, "variable-mappings"]], "Variational autoencoder (VAE) based integration": [[7, "variational-autoencoder-vae-based-integration"]], "Variational autoencoders": [[16, null]], "View and copies": [[19, "view-and-copies"]], "Visual exploration": [[25, "visual-exploration"]], "Visualization": [[2, "visualization"], [14, "visualization"]], "Visualization of single-cell data": [[17, "visualization-of-single-cell-data"]], "Visualize top ligands & regulatory targets": [[25, "visualize-top-ligands-regulatory-targets"]], "Visualizing perturbation responses with Linear Discriminant Analysis": [[16, "visualizing-perturbation-responses-with-linear-discriminant-analysis"]], "Warning": [[5, null]], "Weighted Nearest Neighbor (WNN)": [[28, "weighted-nearest-neighbor-wnn"]], "What about the compositional effect?": [[13, null]], "What is the ground truth?": [[7, null]], "What this book covers": [[30, "what-this-book-covers"]], "What this book does not cover": [[30, "what-this-book-does-not-cover"]], "What to use as the batch label?": [[7, null]], "Who should read this book": [[30, "who-should-read-this-book"]], "Why cell-type count data is compositional": [[13, "why-cell-type-count-data-is-compositional"]], "Will batch correction remove biological differences between conditions?": [[13, null]], "With labeled clusters": [[13, "with-labeled-clusters"]], "With labeled clusters and hierarchical structure": [[13, "with-labeled-clusters-and-hierarchical-structure"]], "Without labeled clusters": [[13, "without-labeled-clusters"]], "fry test for Stimulated vs Control": [[15, "fry-test-for-stimulated-vs-control"]], "fry test for the comparison between two stimulated cell types": [[15, "fry-test-for-the-comparison-between-two-stimulated-cell-types"]], "muon API demo": [[19, "muon-api-demo"]], "mvTCR": [[3, "mvtcr"]], "scIB metrics evaluation": [[28, "scib-metrics-evaluation"]], "t-SNE": [[31, "t-sne"]]}, "docnames": ["acknowledgements", "air_repertoire/clonotype", "air_repertoire/ir_profiling", "air_repertoire/multimodal_integration", "air_repertoire/specificity", "cellular_structure/annotation", "cellular_structure/clustering", "cellular_structure/integration", "chromatin_accessibility/gene_regulatory_networks_atac", "chromatin_accessibility/introduction", "chromatin_accessibility/muon_to_seurat", "chromatin_accessibility/quality_control", "chromatin_accessibility/resources/celltype_markers", "conditions/compositional", "conditions/differential_gene_expression", "conditions/gsea_pathway", "conditions/perturbation_modeling", "deconvolution/bulk_deconvolution", "glossary", "introduction/analysis_tools", "introduction/data_infrastructure", "introduction/interoperability", "introduction/prior_art", "introduction/raw_data_processing", "introduction/scrna_seq", "mechanisms/cell_cell_communication", "mechanisms/gene_regulatory_networks", "multimodal_integration/advanced_integration", "multimodal_integration/paired_integration", "outlook", "preamble", "preprocessing_visualization/dimensionality_reduction", "preprocessing_visualization/feature_selection", "preprocessing_visualization/normalization", "preprocessing_visualization/quality_control", "reproducibility/introduction", "spatial/deconvolution", "spatial/domains", "spatial/imputation", "spatial/introduction", "spatial/neighborhood", "spatial/spatially_variable_genes", "src/lib", "surface_protein/annotation", "surface_protein/batch_correction", "surface_protein/dimensionality_reduction", "surface_protein/doublet_detection", "surface_protein/normalization", "surface_protein/quality_control", "trajectories/lineage_tracing", "trajectories/pseudotemporal", "trajectories/rna_velocity"], "envversion": {"sphinx": 62, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.intersphinx": 1, "sphinxcontrib.bibtex": 9}, "filenames": ["acknowledgements.md", "air_repertoire/clonotype.ipynb", "air_repertoire/ir_profiling.ipynb", "air_repertoire/multimodal_integration.ipynb", "air_repertoire/specificity.ipynb", "cellular_structure/annotation.ipynb", "cellular_structure/clustering.ipynb", "cellular_structure/integration.ipynb", "chromatin_accessibility/gene_regulatory_networks_atac.ipynb", "chromatin_accessibility/introduction.ipynb", "chromatin_accessibility/muon_to_seurat.ipynb", "chromatin_accessibility/quality_control.ipynb", "chromatin_accessibility/resources/celltype_markers.ipynb", "conditions/compositional.ipynb", "conditions/differential_gene_expression.ipynb", "conditions/gsea_pathway.ipynb", "conditions/perturbation_modeling.ipynb", "deconvolution/bulk_deconvolution.ipynb", "glossary.md", "introduction/analysis_tools.ipynb", "introduction/data_infrastructure.md", "introduction/interoperability.ipynb", "introduction/prior_art.md", "introduction/raw_data_processing.md", "introduction/scrna_seq.md", "mechanisms/cell_cell_communication.ipynb", "mechanisms/gene_regulatory_networks.ipynb", "multimodal_integration/advanced_integration.ipynb", "multimodal_integration/paired_integration.ipynb", "outlook.md", "preamble.md", "preprocessing_visualization/dimensionality_reduction.ipynb", "preprocessing_visualization/feature_selection.ipynb", "preprocessing_visualization/normalization.ipynb", "preprocessing_visualization/quality_control.ipynb", "reproducibility/introduction.md", "spatial/deconvolution.ipynb", "spatial/domains.ipynb", "spatial/imputation.ipynb", "spatial/introduction.ipynb", "spatial/neighborhood.ipynb", "spatial/spatially_variable_genes.ipynb", "src/lib.py", "surface_protein/annotation.ipynb", "surface_protein/batch_correction.ipynb", "surface_protein/dimensionality_reduction.ipynb", "surface_protein/doublet_detection.ipynb", "surface_protein/normalization.ipynb", "surface_protein/quality_control.ipynb", "trajectories/lineage_tracing.ipynb", "trajectories/pseudotemporal.ipynb", "trajectories/rna_velocity.ipynb"], "indexentries": {"adapter sequences": [[18, "term-Adapter-sequences", true], [18, "term-adapter-sequences", true]], "algorithm": [[18, "term-Algorithm", true]], "algorithms": [[18, "term-Algorithms", true]], "amplification bias": [[18, "term-Amplification-bias", true]], "anndata": [[18, "term-AnnData", true]], "anndatas": [[18, "term-AnnDatas", true]], "bam": [[18, "term-BAM", true]], "bam files": [[18, "term-BAM-files", true]], "bar code": [[18, "term-0", true], [18, "term-Bar-code", true]], "barcode": [[18, "term-Barcode", true]], "barcodes": [[18, "term-Barcodes", true]], "batch effect": [[18, "term-Batch-effect", true]], "benchmark": [[18, "term-Benchmark", true]], "bulk rna sequencing": [[18, "term-Bulk-RNA-sequencing", true]], "bulk rna-seq": [[18, "term-bulk-RNA-Seq", true]], "bulk sequencing": [[18, "term-bulk-sequencing", true]], "cdna": [[18, "term-cDNA", true]], "cell": [[18, "term-Cell", true]], "cell barcode": [[18, "term-Cell-barcode", true]], "cell state": [[18, "term-Cell-state", true]], "cell type": [[18, "term-Cell-type", true]], "cell type annotation": [[18, "term-Cell-type-annotation", true]], "cells": [[18, "term-cells", true]], "chromatin": [[18, "term-Chromatin", true]], "cluster": [[18, "term-Cluster", true]], "clusters": [[18, "term-Clusters", true]], "codon": [[18, "term-Codon", true]], "complementary dna (cdna)": [[18, "term-Complementary-DNA-cDNA", true]], "cpg": [[18, "term-CpG", true]], "demultiplexing": [[18, "term-Demultiplexing", true]], "directed graph": [[18, "term-directed-graph", true]], "dna": [[18, "term-DNA", true]], "doublets": [[18, "term-Doublets", true]], "downstream analyses": [[18, "term-downstream-analyses", true]], "downstream analysis": [[18, "term-Downstream-analysis", true]], "drop-seq": [[18, "term-Drop-seq", true]], "dropout": [[18, "term-Dropout", true]], "edit distance": [[18, "term-Edit-distance", true]], "fastq": [[18, "term-FASTQ", true]], "fastq reads": [[18, "term-FASTQ-reads", true]], "flowcell": [[18, "term-Flowcell", true], [18, "term-flowcell", true]], "gene expression matrix": [[18, "term-Gene-expression-matrix", true]], "hamming distance": [[18, "term-Hamming-distance", true]], "imputation": [[18, "term-Imputation", true]], "indrop": [[18, "term-Indrop", true]], "library": [[18, "term-Library", true]], "loci": [[18, "term-Loci", true], [18, "term-loci", true]], "locus": [[18, "term-Locus", true]], "modalities": [[18, "term-Modalities", true]], "mudata": [[18, "term-MuData", true]], "multimodal": [[18, "term-Multimodal", true]], "muon": [[18, "term-Muon", true], [18, "term-muon", true]], "negative binomial distribution": [[18, "term-Negative-binomial-distribution", true]], "pcr": [[18, "term-PCR", true]], "pipeline": [[18, "term-Pipeline", true]], "poisson distribution": [[18, "term-Poisson-distribution", true]], "promoter": [[18, "term-Promoter", true]], "pseudotime": [[18, "term-Pseudotime", true]], "rna": [[18, "term-RNA", true]], "rna velocity": [[18, "term-RNA-velocity", true]], "rt-qpcr": [[18, "term-RT-qPCR", true]], "sam": [[18, "term-SAM", true]], "sam files": [[18, "term-SAM-files", true]], "scanpy": [[18, "term-scanpy", true]], "scverse": [[18, "term-scverse", true]], "signal-to-noise ratio": [[18, "term-signal-to-noise-ratio", true]], "spike-in rna": [[18, "term-Spike-in-RNA", true]], "splice junctions": [[18, "term-Splice-Junctions", true], [18, "term-splice-junctions", true]], "trajectory inference": [[18, "term-Trajectory-inference", true]], "umi": [[18, "term-UMI", true]], "unique molecular identifier (umi)": [[18, "term-Unique-Molecular-Identifier-UMI", true]], "untranslated region (utr)": [[18, "term-Untranslated-Region-UTR", true]], "utr": [[18, "term-UTR", true]]}, "objects": {}, "objnames": {}, "objtypes": {}, "terms": {"": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 28, 29, 30, 32, 33, 34, 36, 37, 38, 40, 43, 45, 47, 48, 49, 50, 51], "0": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "00": [1, 3, 4, 5, 7, 11, 13, 19, 25, 26, 27, 28, 36, 37, 38, 40, 41, 49, 51], "000": [2, 3, 5, 7, 13, 23, 24, 26, 32, 49], "0000": [3, 13, 25], "00000": [3, 25], "000000": [3, 7, 13, 17, 19, 25], "000001": 25, "000002": [4, 15, 25], "000003": [17, 25], "000006": 17, "000007": 17, "000008": 25, "00001": 25, "000017": 4, "000019": 17, "000023": 4, "000065": 17, "000066": 17, "000072": 17, "000076": 17, "000086": 17, "000091": 17, "000093": 41, "000099": 41, "0000e": 27, "000122": 17, "000125": 17, "000131": 41, "0001382038": 7, "000156": 17, "000160": 17, "000170": 17, "000200": 17, "000212": 17, "000219": 17, "000221": 17, "000247": 17, "000262": 15, "0002657828": 7, "000309": 17, "000328": 17, "000353": 17, "000354": 17, "00036": 27, "000370": 17, "000379393": 7, "000380": 17, "000393": 17, "000399": 17, "000412": 17, "000414": 17, "000422": 17, "000425": 17, "0004299227": 7, "000430": 17, "00044": 27, "000454": 17, "000457": 17, "000468": 17, "000483": 17, "00050": 27, "000504": 17, "000516": 17, "0005365199": 7, "000577": 17, "00058": 27, "000586": 17, "000594": 17, "000648": 17, "00065": 27, "000733": 17, "000744": 17, "000744047619047619": 37, "000750": 17, "000761": 17, "000781": 17, "000785": 17, "000795": 17, "0007981117": 7, "000801": 17, "000825": 11, "00082514": 11, "0008381943": 7, "0009021682": 7, "000911": 17, "000919": 17, "000936": 17, "000945": 17, "000954": 17, "000e": 40, "001": [17, 24, 26, 37, 38], "001041": 17, "001109391": 7, "001152": 49, "001153": 17, "001174": 17, "001175": 17, "001177": 17, "001213": 17, "001298": 17, "0013": 21, "001302": 17, "001318": 17, "001326": 17, "001406": 17, "001537": 17, "001551": 17, "00157": 50, "001589": 14, "001641": 41, "001676": 17, "001680": 17, "001693": 41, "001739": 41, "001748": 41, "001784": 17, "001793": 17, "001799": 17, "001814": 17, "001871": 7, "001998": 16, "002": [2, 13, 23, 24, 27, 36, 38, 44], "002024": 17, "002113": 17, "002119": 17, "002153635": 7, "002156": 17, "002171": 17, "002195": 17, "002209": 17, "002286": 17, "002291": 17, "002296": 17, "002298": 17, "002305526": 7, "002317": 17, "00233": 27, "002331": 16, "002371": 17, "002390": 17, "002456": 17, "002554": 47, "002572e": 17, "00258": 27, "002595": 13, "002626": 17, "00266": 38, "002712": 14, "002719": 17, "00273": 27, "002739": 17, "002818": 17, "002869": 17, "002915": 15, "00292": 25, "002960": 17, "003": [2, 23, 30], "003021": 17, "003037": 17, "003172": 36, "003196878": 7, "003224": 17, "003329": 17, "003351e": 15, "003378": 17, "003379": 17, "00340": 28, "003435": 17, "003446": 17, "003457": 36, "003507": 17, "003632830": 7, "003656": 17, "003657": 17, "003669": 41, "003723": 41, "003772": 17, "00381": 27, "003820": 17, "003832": 17, "003837952": 7, "003925": 17, "003949": 17, "004038": 41, "004070": 17, "004111": 17, "004145": 15, "004153": 17, "004242": 17, "004296": 17, "004478": 17, "004530": 17, "004607": 17, "004650": 17, "004655": 17, "004663": 14, "004735": 17, "004801": 17, "004823": 17, "004873": 17, "004921": 17, "004927": 17, "005": [23, 24, 27, 37, 38, 50], "00512": 9, "005149": 17, "00515": 39, "005165": 17, "005200": 17, "005269": 17, "005295": 7, "005392": 17, "005433": 17, "005464": 17, "005490": 17, "0055208620": 7, "005524": 17, "005578": 15, "00561": 16, "005645": 17, "005755797": 7, "005848": 17, "00586": 30, "005951634": 7, "006": [17, 27], "006030": 17, "006261": 17, "0063": 9, "006337": 17, "0063816143": 7, "006430": 36, "006444": 17, "006472": 17, "006533": 7, "006566": 17, "006685": 17, "006749": 17, "006784": 25, "006798": 17, "0068": 50, "007": [25, 27], "007052": 13, "007055": 36, "007094": 25, "0071": 50, "007149": 17, "007268": 25, "007273": 17, "007285": 25, "0073": 24, "007331": 14, "007348": 17, "007417": 17, "0075": 37, "007564": 25, "007645": 17, "007646": 17, "00769": 49, "007700": 17, "007707": 36, "007733": 25, "007761": 25, "00778": 16, "007855": 25, "00790": 9, "007911": 17, "008": 34, "008009": 17, "008010": 17, "00803": 13, "0082": 2, "00830": 36, "008307": 17, "008431": 17, "008490": 17, "008506": 17, "008620": 36, "008648": 17, "008649": 25, "00870": [23, 51], "008748": 25, "00874999999999": 37, "008824": 17, "008826": 17, "008832": 17, "008907": 25, "00895": 7, "008957": 17, "009015": 25, "009087": 36, "009102": 17, "009149": 17, "009212": 17, "00927": [48, 50], "009382408": 7, "009437": 7, "009512": 17, "0095352521": 7, "009583": 41, "00965": 24, "009778": 17, "009929": 17, "00it": 4, "01": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 36, 37, 39, 40, 41, 47, 48, 49, 50, 51], "010": [23, 40], "010006": 17, "01001": 5, "010049": 14, "010065": 25, "010111": 25, "010171": 17, "01018986": 40, "0102285085": 7, "010231": 36, "01033": 13, "010418": 17, "01050": [27, 28], "010565": 17, "010730e": 17, "010780": 17, "010830": 13, "010837": 17, "010936": 16, "010955783": 7, "010972": 17, "0109928448": 7, "011": [2, 17], "011042": 17, "011122931": 37, "011133475": 7, "011144": 17, "011156": 17, "011228": 17, "011261": 17, "0113": 7, "01139": 36, "011393": 17, "0114": 17, "01143158": 7, "011449": 17, "011488e": 41, "011544715": 7, "011891": 17, "011961": 17, "012": [5, 7, 13, 24], "012059": 17, "01206": 7, "0121073040": 7, "01227": 7, "012439": 17, "01247": 36, "012580": 25, "012603": 13, "012610": 17, "01264": 38, "012677": 17, "01272": 36, "012727": 17, "01284": 27, "012894": 17, "012962": 17, "013": 13, "013065": 17, "013067": 25, "013183394": 7, "013188": 17, "013241": 17, "013295": 14, "013301": 17, "013302": 17, "013317": 17, "0133178897761": 37, "013332": 17, "013337": 17, "01336": [7, 28], "01346": 51, "013523": 17, "013575": 17, "01358": [19, 37, 40, 41], "013670": 17, "013744": 17, "013826": 36, "013858992": 7, "0139047071": 7, "0139905515": 7, "014": [1, 2, 4, 13, 14, 48], "014011": 17, "01408": 51, "014090": 17, "014266": 17, "014339": 36, "014482": 17, "014647": 17, "01480": [36, 38], "014837": 17, "014846": 17, "015": [5, 14, 17, 23, 24], "015055": 17, "015060": 17, "015091": 17, "015157": 17, "015228": 17, "015318": 17, "015371": 17, "015419": 17, "015445186": 7, "015501": 3, "015595": 17, "015624": 17, "015769": 17, "015810": 17, "015843": 17, "015938": 17, "016": [24, 39, 48], "016110": 17, "0162": 7, "016462": 17, "016581": 17, "016660": 17, "0169": 21, "017": [17, 19], "0171909615": 7, "017265": 36, "017268": 17, "017479": 17, "017518": 17, "017529": 17, "017618": 17, "017720": 17, "017742": 17, "017743": 17, "017747": 17, "01777767": 7, "017800": 36, "017824": 17, "017958": 17, "018": [2, 7, 9, 16, 23, 24, 44, 49, 50, 51], "018025385": 7, "018073": 17, "01814": 33, "018144": 17, "018155": 17, "018158": 17, "0183198213": 7, "018500": 17, "018764": 17, "018820e": 15, "018999": 16, "019": [5, 6, 7, 9, 11, 13, 14, 16, 17, 22, 23, 24, 25, 31, 32, 41, 44, 50, 51], "019028": 36, "019050": 17, "01905311": 40, "019102": 17, "019180": 15, "019181": 17, "019282": 17, "019290": 17, "019330": 17, "019351": 17, "019374": 36, "019886": 17, "019928": 11, "01it": 4, "01m": 7, "02": [1, 4, 7, 13, 14, 17, 21, 24, 25, 27, 38, 40, 41, 51], "020": [5, 7, 13, 14, 16, 23, 24, 25, 27, 28, 32, 33, 34, 36, 50, 51], "02015": 28, "020330": 17, "02040172": 7, "020538": 17, "020691": 13, "02071": 23, "020842": 17, "020848": 17, "0209648": 24, "020e": 40, "021": [5, 7, 9, 11, 13, 14, 16, 19, 23, 24, 25, 28, 30, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "02100047": 40, "021004": 13, "02116382": 11, "021283": 17, "021311": 17, "021337": 17, "021343": 17, "02136": [32, 33, 34], "021414": 17, "021438": 17, "021531": 17, "021775": 17, "022": [5, 9, 14, 25, 27, 36, 38, 39, 41, 47, 49, 50, 51], "022174": 36, "022198": 17, "022236": 17, "02224": 13, "022288": 17, "022354": 17, "022406": 17, "022560136": 7, "022603": 17, "02269": 38, "022855": 17, "0229": [7, 44, 49], "023": [5, 13, 30, 33], "023071": 7, "02312621": 40, "0232357011": 7, "023237586": 7, "02327": 5, "023478": 17, "023484": 17, "02366670": 7, "023929": 17, "024": 4, "02404": 41, "024063": 17, "02414": 51, "024230": 17, "024462": 7, "024532": 17, "024641": 17, "02469": 11, "025": 13, "025152": 17, "02519": [23, 30, 34], "025195": 17, "025210": 17, "025247": 17, "025266": 17, "025306": 41, "0254": 7, "025445": 21, "025473": 17, "02552": 23, "025538": 17, "025631": 17, "025682": 14, "025715": 17, "025763467": 7, "02577": [19, 48], "025812": 17, "026012": 36, "026051": 36, "026074": 17, "026425": 17, "026449": 11, "026496": 17, "026507": 17, "026611": 17, "026912": 36, "027": [4, 13], "027290": 17, "027294": 17, "027501": 17, "027782": 17, "02783": 25, "028101": 17, "028191": 11, "02819141": 11, "028242": 17, "028406": 17, "028456": 7, "028745": 17, "028784": 17, "028895": 17, "029": 2, "029131": 17, "0292": 25, "029331": 17, "029334": 17, "029488": 36, "029637": 17, "029776": 17, "02_clonotyp": 4, "03": [4, 5, 7, 9, 15, 21, 23, 25, 27, 28, 36, 40, 41, 48, 50], "030": [4, 13], "030072": 17, "030433": 17, "030663e": 15, "030714": 7, "030763": 17, "031": [5, 7], "031009": 17, "031298": 17, "0313151274": 7, "031351": 17, "031499": 17, "031523": 17, "031593": 17, "031727": 41, "0317359576": 7, "03175": [39, 41], "031832": 14, "031883": 17, "031902": 17, "031905": 17, "031938502": 7, "032441": 17, "032812e": 7, "032995": 17, "033144": 36, "033312": 17, "033652": 41, "033807": 13, "033820": 17, "0341661907": 7, "034702669886504146": 3, "034764": 17, "034838": 17, "035044": 17, "035206": 17, "035495": 17, "035848768": 7, "035979": 17, "036": [2, 44], "036180": 17, "036258": 17, "036429": 17, "036592": 17, "0367": 9, "036719": 17, "036769": 41, "036793": 17, "03693412": 40, "036951": 17, "037": 2, "037017": 17, "037059": 7, "037080": 17, "037086": 36, "03708733": 40, "037690": 17, "037749": 17, "037775": 17, "037869": 17, "03793": 5, "038": 13, "038030": 17, "038063": 17, "038076743": 7, "038107": 17, "038413": 17, "038598": 17, "038787": 17, "038888": 36, "039": [2, 27], "039067": 17, "039231": 17, "03929": 50, "0394717101": 7, "0398862297": 7, "03it": [4, 19], "04": [4, 5, 7, 8, 9, 13, 14, 15, 17, 19, 21, 22, 23, 24, 25, 27, 28, 47, 48], "0400": 25, "040034": 36, "040259": 36, "040401": 17, "040612": 36, "040700": 17, "040736": 17, "040750": 17, "040768": 17, "040867": 17, "040876": 17, "040e": 40, "041": [17, 27], "04109503": 40, "041130": 25, "041143": 13, "041302": 36, "041347": 17, "0414": [50, 51], "0416": 25, "04166": 51, "041832": 14, "042": 27, "0428727350273357e": 3, "043106": 7, "043131": 17, "043424": 41, "044": 24, "04440": 21, "044578": 17, "044600": 36, "04489": 13, "044896": 17, "045": [1, 2], "045312": 17, "045383": 17, "04541": 5, "045437": 17, "045462": 17, "045747": 36, "045796": 17, "046026e": 15, "046150": 17, "0461501": 40, "046156": 17, "0465": 24, "0469": 24, "04695830342547": 37, "047328": 17, "047461e": 15, "047486": 7, "047501": 17, "047504": 14, "0477": 25, "047839": 17, "048": [5, 14, 19, 27, 28], "048005": 36, "048209": 16, "048237": 17, "048438": 17, "048755": 17, "048820": 17, "04918": 25, "04922": 49, "0494": 7, "049647": 17, "04it": 25, "05": [1, 3, 4, 5, 7, 8, 9, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 27, 28, 37, 41, 44, 47, 48, 49, 50, 51], "0503999": 40, "05046": 50, "05060": 36, "0508": 25, "051093": 36, "051506": 7, "051597": 17, "052031": 17, "052365": 17, "052478": 17, "0527": 25, "0528": 2, "0529": 5, "052970708": 7, "053040": 17, "053345": 36, "0534": 25, "0535": 5, "053514": 17, "053946": 16, "054": 13, "054286": 17, "054419895": 7, "054454": 17, "054697": 14, "0550": 14, "055291e": 15, "055324": 36, "055596": 17, "055801": 36, "056105": 13, "05617137": 7, "056218": 17, "056370": 17, "056550": 17, "056698": 41, "056839": 17, "057": 13, "057406": 17, "057679": 7, "0578": 25, "058150": 13, "058162": 36, "058451": 16, "058535": 17, "0586": 25, "058816": 17, "059066": 17, "0591": [50, 51], "059664": 36, "06": [2, 4, 5, 7, 14, 17, 21, 25, 27, 41, 49, 51], "060": [2, 13], "060012": 15, "060052": 17, "060295": 17, "060488": 17, "0605": 16, "060557e": 41, "0609319ns_pass": 10, "061": 27, "061176": 17, "061238": 27, "061254": 17, "061422": 41, "061855": 36, "0619": [7, 44], "062": [13, 44], "062043": 17, "062383": 25, "062643e": 41, "062904": 17, "06307772": 7, "063412": 11, "06341238": 11, "0634131457": 7, "063421": 17, "063592": 17, "063762": 25, "063919": 17, "064": [1, 4], "064095": 36, "064172": 17, "064833e": 15, "0654": [22, 24], "065401e": 41, "066": [1, 14], "066143": 13, "0662": 25, "066304": 17, "0667": 25, "06673556": 40, "067": 1, "067159": 14, "0678": 25, "067906": 17, "0684": 23, "069194": 17, "0694": 25, "069586": 36, "069872": 38, "06e": 16, "07": [2, 3, 4, 5, 7, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 41, 44, 51], "0701": 41, "07013584": 7, "070147": 25, "070524": 25, "07070432": 40, "071": 13, "07143": 21, "071472": 36, "071492": 17, "071568": 17, "071622": 17, "07165": 21, "071987": 13, "072006": 17, "072228": 17, "07226": 25, "072739": 25, "073": 13, "073604": 13, "073787": 17, "073812": 25, "07394278049468994": 37, "07412227": 40, "0745": 25, "074556": 25, "074642": 25, "074791": 25, "075": 2, "075350": 25, "0755": 25, "075502": 25, "0765": 25, "076776": 7, "076892": 36, "077152": 25, "078150": 47, "078486": 25, "0786": 25, "078720": 17, "078934": 13, "078945": 25, "079524e": 14, "079577": 17, "07959": 25, "079590": 17, "079864e": 7, "07it": 25, "08": [1, 3, 4, 7, 11, 13, 15, 17, 19, 21, 25, 26, 28, 29, 37, 41, 51], "080234e": 15, "0803": 25, "080626": [17, 25], "080e": 40, "0812": 25, "081810": 17, "082": 23, "082027580": 7, "082158": 36, "082315": 25, "082443": 17, "082823": 36, "083236": 17, "083241": 36, "083460": 13, "084": 13, "0844": 14, "084500": 7, "084937": 17, "085": [2, 13], "0856": 25, "085672": 17, "085893": 17, "086": 13, "0864": 25, "086884": 17, "087671": 17, "087746": 36, "087951": 17, "088082": 17, "088092": 17, "0882": 25, "088418": 3, "08937": 13, "08it": 4, "09": [1, 4, 5, 7, 9, 13, 15, 17, 21, 23, 25, 27, 28, 36, 38, 41, 50], "090": 13, "090013": 17, "090483": 17, "090575": 17, "091188": 17, "091884": 25, "09205304": 40, "092170": 17, "092188e": 25, "0935": 50, "094": 13, "0941": 25, "09498141": 40, "095742": 17, "095896": 17, "096202": 16, "096780": 16, "0969": 23, "096936": 17, "097204": 17, "097628": 17, "098": 13, "098612": 19, "0994335574766187e": 3, "099594": 17, "09990": 17, "0m": [3, 5, 7, 16, 27, 28, 50], "0x124cf9c30": 13, "0x125a9ec30": 13, "0x1265f3c30": 13, "0x1278c5c30": 13, "0x127cb9c30": 13, "0x129969c30": 13, "0x12ad09c30": 13, "0x12ee9ac30": 13, "0x12f0f1c30": 13, "0x12f11cc30": 13, "0x131710c30": 13, "0x131764c30": 13, "0x132a2ec30": 13, "0x1343f7c30": 13, "0x13455ec30": 13, "0x13a4136b0": 13, "0x13b1576b0": 13, "0x13bdb76b0": 13, "0x13d0326b0": 13, "0x13d4106b0": 13, "0x13f0d36b0": 13, "0x1404af6b0": 13, "0x1446806b0": 13, "0x1448ce6b0": 13, "0x146e806b0": 13, "0x146ee86b0": 13, "0x1481d76b0": 13, "0x149ba86b0": 13, "0x149c2f6b0": 13, "0x160630220": 48, "0x16070be50": 48, "0x1607a2550": 48, "0x160aa2f70": 48, "0x16af6f460": 48, "0x17bed0340": 48, "0x18a243040": 21, "0x18ef5ec30": 13, "0x19ad2cd90": 13, "0x19be736b0": 13, "0x7f6f9a129280": 28, "0x7fc377ccce10": 26, "0x7ff53cc2e2b0": 1, "1": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "10": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "100": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 16, 19, 21, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 42, 47, 49, 50], "1000": [3, 7, 11, 13, 16, 19, 23, 24, 25, 30, 34, 36, 37, 40], "10000": [1, 7, 8, 13, 24, 27], "100000": [7, 11, 48], "1000000": 19, "100006224": 8, "100006224100006224": 8, "100008": 48, "100009": 2, "1000px": 42, "1001": 50, "100182": 9, "1002": [6, 24, 48], "10026": 3, "100344": 50, "1005": [21, 41], "100699": 34, "1007": [5, 7], "100954": 17, "100bp": 11, "100e": 40, "100k": 13, "100x2000": 19, "101": [8, 23, 26, 37, 49], "1010": 48, "1010031": 51, "10112": 11, "10115791": 40, "1012": 4, "1015": 5, "1016": [5, 7, 14, 17, 19, 23, 24, 25, 26, 27, 28, 30, 34, 39, 48, 50], "101973": 25, "102": [2, 15, 27], "1023": 13, "1023818214614": 13, "102628": 14, "10270": 7, "10270x13431": 7, "10272": 11, "1028": 2, "103": [8, 25, 27, 28, 36], "10331": 27, "1038": [2, 5, 6, 7, 9, 13, 14, 16, 17, 19, 22, 23, 24, 25, 27, 28, 30, 31, 33, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "104": [13, 25, 40], "1045": 47, "104626": 36, "10465": 27, "104858": 17, "105": [4, 8, 49], "1053": [5, 7, 40, 44, 49], "10561": 4, "1056489": 50, "1058": [5, 7, 44, 49], "106": [1, 7, 11, 25, 27, 28, 36, 49], "1064": 49, "10648": 11, "10665270050081478": 23, "107": [8, 49], "1072": 49, "10726": 38, "1073": [13, 24, 51], "107962": 15, "108": [13, 25, 49], "1080": 40, "1083": [15, 26], "108395": 2, "1084": 6, "1086": [15, 26], "108737e": 14, "1088": [6, 25], "108887": 17, "10889": 1, "1089": [16, 23], "109": [1, 8, 25, 27, 37, 49], "1090": 47, "109078": 17, "10915": 4, "10919": 4, "1093": [2, 4, 5, 7, 9, 14, 17, 19, 23, 25, 34, 36, 38, 41, 47], "1096": 6, "109806": 17, "109896": 13, "10e3": 11, "10e4": 11, "10px": 42, "10th": 23, "10x": [2, 3, 5, 6, 7, 9, 11, 14, 16, 19, 23, 24, 28, 34, 36, 37, 38, 39, 40, 41, 49], "10xg19": 3, "10xgenom": [2, 23, 37], "10xv3": 23, "11": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 47, 49, 50, 51], "110": [13, 49, 50], "11000": 13, "1101": [5, 7, 9, 13, 14, 19, 23, 25, 27, 28, 29, 37, 41, 47, 48, 50, 51], "1102": [7, 27], "1103": 24, "110367e": 17, "110393": 25, "11049": 24, "1107": 21, "110882": 50, "1109": 50, "111": [1, 5, 8, 13, 16, 25, 28, 49], "111008": 17, "1111": [13, 14], "111433": 17, "111516": 17, "112": [7, 13, 24, 25, 27, 49], "11238": 16, "112478": 17, "1126": [5, 17, 25, 50, 51], "11260235": 40, "1129": 25, "11290": 7, "112m": 21, "113": [8, 27, 49], "113m": 21, "114": [13, 27, 48], "1140": 40, "114149766": 7, "11432": 26, "1145": [5, 6, 50], "114610": 17, "115": [8, 19, 22, 25, 27, 49], "1150": 23, "11501": 1, "1151": 50, "11522": 4, "115270": 11, "1156": 50, "1158": 23, "1159": 14, "115m": 21, "116": [2, 13, 25, 49], "1160": [1, 5, 6, 26, 50], "116168": 11, "116394": 21, "116434": 43, "116490": 7, "1167": 50, "116715": 48, "117": [8, 27], "11725": 36, "117283": 17, "118": [7, 13, 25, 27], "118563": [47, 48], "1186": [2, 5, 6, 7, 11, 13, 14, 16, 17, 19, 23, 24, 25, 28, 30, 32, 33, 34, 41, 48, 50, 51], "1187": 24, "1188": [21, 27, 28], "11889": 21, "118m": 21, "119": [5, 8, 15, 49], "1191": 14, "1192": 21, "1193": 49, "11956": 34, "1197": 24, "119837": [44, 45, 46], "119886875152588": 37, "12": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 34, 36, 38, 39, 40, 43, 44, 48, 49, 50, 51], "120": [1, 4, 23, 40, 48, 49], "1201": 24, "1202": [21, 23, 24], "120502": [27, 28, 43, 46], "12054": 16, "1209": 21, "121": [4, 5, 8, 13, 19, 22, 25], "121110e": 14, "1214": [23, 24], "1218": 14, "1219": 21, "12198": 16, "122": [48, 49], "122016": 48, "1221": 21, "122208": 17, "12268": 14, "122690": 36, "1228": 19, "123": [8, 15, 26, 27, 28, 34], "1230": 21, "12301": 25, "1231": 21, "123245": 25, "1233": 21, "1234": 13, "123504": 25, "123505733": 7, "12362": 4, "12363": 4, "12364": 4, "12365": 4, "12366": 4, "12367": 4, "123673": 21, "124": [2, 25, 48], "1240": 21, "1242": 51, "12427134": 11, "1243": 14, "1246": [21, 48, 50], "1249": 49, "125": [8, 13, 37], "1250": [11, 24], "1251": 3, "1253": 49, "125658": 37, "125729": 17, "1258": [48, 50], "1259": 3, "126": [13, 27], "126003": 13, "126119": 7, "126146": 21, "1262": 21, "1263": 21, "1264": 21, "126413": 19, "126426": 13, "1265": 21, "1268": 21, "126846": 14, "12688": [5, 6, 7], "127": [7, 8, 13, 25, 26], "1270": 21, "1274": 21, "127703": 36, "128": [7, 16, 40, 48, 49], "128015": 17, "1281": 14, "128496": 21, "128713": 17, "1289": [21, 44], "129": [7, 8, 25, 27, 50], "1290": 40, "1292": 4, "1293": 4, "1296": [21, 44], "129921": [7, 26], "12it": [4, 5], "13": [1, 2, 3, 4, 5, 7, 8, 13, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 36, 37, 40, 41, 47, 49, 50], "130": [2, 5, 24, 25], "1304975216": 49, "13056": 31, "131": [7, 8, 13, 27], "131391": 17, "13157661": 40, "1317": 17, "132": [13, 16, 27, 38], "132153e": 41, "13236": 25, "13237": 25, "13238": 25, "13239": 25, "13240": 25, "1326": 4, "132748287": 37, "132763": 17, "132866": 36, "133": [8, 25], "1330": 40, "13319079238387194": 1, "133349": 17, "13344": 13, "133453": 7, "1337": 9, "133780e": 17, "133848": 17, "133m": 21, "134": [3, 49], "13407": 13, "13408": 13, "13409": 13, "13410": 13, "13411": 13, "13414": 13, "1342": [37, 41], "13431": [7, 8, 26], "13432": 8, "1344": 40, "1349": 17, "13490": 13, "13492": 13, "135": [4, 8, 13, 27], "1351": [37, 41], "1352": [38, 40], "13548": 11, "136": [25, 27, 28, 43, 45, 48], "1360": 36, "1362": 38, "1363": [15, 26], "1364": 24, "13660": 13, "136754": 25, "1369": [36, 50], "13699": 13, "137": [8, 22, 49, 50], "13702": 4, "137064": 15, "13708": 17, "1371": [24, 51], "1375": [15, 26], "13757": 13, "137689": 17, "137952e": 15, "138": [17, 23, 49], "1382": [19, 40], "1387": 26, "139": [8, 13, 14, 23, 25], "139282": 41, "1396": 49, "13it": 4, "14": [1, 2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 16, 21, 23, 24, 25, 26, 27, 28, 36, 37, 40, 44, 47, 48, 49, 50], "140": [13, 14, 16, 38, 40, 44, 46, 47, 48], "1401": 49, "14049": [23, 24], "1408": [50, 51], "1409": 49, "140e": 40, "141": 8, "141245": 21, "1413": 21, "1414": [50, 51], "14141": 17, "1416": 21, "14171": 1, "14172": 1, "14173": 1, "14174": 1, "14175": 1, "14176": 1, "14177": 1, "14178": 1, "14179": 1, "14180": 1, "14181": 1, "1419": [17, 26], "141ab989ae794394fb6c441d50c0ea6771f96a8d048a8a4c400c10dba267b97c": 2, "142": [13, 24, 25, 27], "14239": 13, "142890": 47, "143": [4, 8, 13, 26], "143153": 13, "143267": 25, "14327": 13, "143465e": 17, "14348": 13, "14348115": 7, "14356": 13, "14364": 36, "1438": 49, "144": [2, 3, 13, 26, 27], "1440": [17, 26], "144075e": 7, "144218": 16, "1444": 14, "144852": 17, "145": [8, 22, 23, 25, 40], "14518": 17, "14530it": 1, "145556": 16, "1457": 27, "145847": 25, "146": [13, 27, 49], "14603": 17, "147": [8, 27], "1471": 17, "14710": 10, "147686": 25, "147717": 25, "14772134": 40, "148": [13, 25], "14814": 34, "1484": 25, "148463": 17, "1488": 49, "1489": 2, "149": [8, 13, 49], "14950": 17, "149544e": 14, "149598e": 25, "1498": 49, "14seuratproject": 10, "14seuratproject1409": 10, "14seuratproject166610777110336051052495336171123": 10, "14seuratproject170410836993326850612450326969953": 10, "14seuratproject170711283588179727381409179935913": 10, "15": [1, 2, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 41, 43, 44, 49, 50], "150": [2, 4, 13, 14, 19, 23, 48, 49], "1500": [1, 3, 11, 48], "15000": [11, 19], "150000": 11, "15000000000000002": 3, "1506": 25, "1507125112": 24, "151": [8, 13, 14, 25, 49], "151255": 25, "151268": 41, "1513": 25, "1517": 24, "152": [13, 27], "1520": 24, "15215": 13, "15223": 13, "15240": 34, "152494": 17, "15252": [7, 14, 22, 29, 50, 51], "15256": 13, "15286": [11, 17], "153": 8, "15339": 11, "1536": 4, "153601547": 7, "15377": 11, "15386": 11, "153936": 2, "154": [2, 27], "154015": 11, "154027": 11, "15434": 17, "15443": 4, "1546": 49, "15474": 25, "155": [8, 13, 27, 30], "155074": 15, "15534039": 11, "15545": 15, "15550": 15, "155726": 17, "1558": 49, "155918": 16, "15596521": 4, "156": [23, 27], "1564": 11, "15666": 6, "156763": 25, "157": 8, "15701": [14, 25], "15706": [14, 15, 16], "15735": 17, "157825": 17, "158": [13, 27], "15809": 6, "15843296": 40, "158681": 25, "159": [4, 8, 13, 25, 27, 51], "159185": 2, "159446": 2, "159738": 14, "15d": 49, "15k": 11, "15m": 21, "15px": 42, "16": [1, 2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 34, 36, 37, 44, 47, 49, 50, 51], "160": [7, 13, 40], "1600": 36, "160046": 17, "1603": 16, "16046": 27, "16065": 34, "161": [13, 23, 24, 25, 27, 28], "1610": 3, "1614": 14, "16184": 17, "162": [7, 21, 25, 26], "1621": 16, "162105": 36, "162173": 17, "162506": 28, "1627": [17, 28], "1628": 28, "16294": [27, 28], "162945": 15, "163": [2, 4, 7, 23, 24, 27], "16311": 28, "16381548": 40, "164": [13, 27], "1640": 17, "16458": 17, "16483": 11, "164895": 17, "164m": 21, "165": [13, 27, 48], "16520": 17, "165263": 17, "16534": 17, "165866e": 25, "166": [13, 23, 24, 27, 36, 49], "166156": 17, "16621": 17, "1663": [6, 50], "1665": 24, "167": [27, 49], "1670": 51, "1676": 14, "167809": 21, "1679": [7, 26], "168": [25, 27, 30, 49], "168599": 21, "16863": 17, "16875": 17, "16877": 11, "169": [27, 49], "1690": 4, "16907": 17, "16934": [11, 34, 48], "169340000": 11, "1694": 34, "16953": 1, "1696": 11, "16k": 11, "16m": 21, "16min": 15, "17": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 21, 22, 23, 24, 25, 26, 27, 36, 37, 40, 41, 47, 48, 49, 50], "170": 51, "17000": 24, "1704": 14, "17041": 13, "170412": 17, "171": [2, 19, 25, 26, 27, 37, 40, 41], "17115": 17, "1716": 16, "1718": 23, "172": 27, "17235": 17, "17237": 17, "17243": [27, 28], "17247": 17, "17251": 17, "1727": [17, 23], "17274": 17, "172740e": 7, "1728": 25, "173": [13, 27], "17301353": 40, "173036": 7, "17318": 17, "17353": 17, "17376": 11, "1738": 14, "173849": 51, "17387": 17, "1739": 15, "17396": 17, "174": 13, "1740": 15, "1742": [6, 23], "17429": 17, "174486e": 17, "175": [27, 49], "1750": 11, "17513": 17, "1752": 23, "17526": 17, "175727": 17, "1758": [1, 34], "176": [7, 34, 37, 49], "17604": 17, "176318": 13, "17662": 17, "177": [7, 15, 27], "1771": [7, 26], "17736": 17, "177582": 17, "1777": 37, "17774": 17, "1778": 24, "178": [19, 27, 37, 40, 41], "17800": 24, "17865": 17, "1792": 37, "17922": 17, "1795": 5, "17966": 38, "1797": [8, 26], "17987": 17, "179935913": 10, "179994e": 17, "17it": 36, "17m": 21, "18": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 37, 38, 40, 41, 44, 49, 50, 51], "180": 25, "18009": 17, "1805": 16, "18078": 37, "180847": 17, "1809": 17, "1809919733": 7, "180deg": 42, "181": 13, "181107": 11, "18118": 17, "1814847": 40, "1815": 1, "181768": 11, "181982": 17, "182": [4, 17, 26, 27], "18223": 17, "182253e": 7, "1824": 7, "18250": 17, "1829": 23, "183": 27, "1830": 11, "1836": 23, "183673": 21, "1839": 24, "18390": 17, "183973": 11, "184": [5, 13, 27, 28, 41, 48], "18432": 17, "184845": 11, "184m": 21, "185": [5, 27, 37, 49], "1850": 7, "1854": 11, "1857": 14, "18579912": 40, "18585": 17, "185917": 19, "18598": 17, "186": [13, 26], "186098": 14, "1861": 32, "18646": 17, "18649": 16, "186743": 17, "18675": 17, "1869": 24, "187": 27, "18701": 17, "18756": 17, "18776": 16, "18786": 17, "188": [2, 25, 27], "188391": 25, "1888": 7, "189": [27, 48], "18906": 11, "1898": 21, "18e": 13, "18m": 21, "18px": 42, "19": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 36, 37, 38, 40, 41, 43, 44, 49, 50, 51], "190": 13, "1902": 7, "19034": 2, "1904": 13, "1905": [38, 49], "190628": 11, "191": 13, "191237": 11, "1917": 17, "191832": 17, "192": [13, 27], "1920": 25, "192111": 11, "1923": 49, "1926": 14, "1929": 25, "193": [2, 13, 27, 41], "1930": 1, "1932": 1, "1933": 21, "1938": 33, "194": [5, 27, 34], "19402": 4, "1941": 21, "19469": 17, "1947": [14, 21], "195": 13, "1950": 34, "1953": 24, "1957": 31, "1958": [21, 49], "196": 27, "1960": 21, "1963": 49, "1965": [21, 24], "196633": 11, "1967": 50, "1969": 21, "196957": 2, "197": 1, "1970": 49, "19711": 48, "1972": 24, "197475": 17, "1979": 41, "198": [13, 27], "1981": 49, "1982": [13, 50], "1983": 49, "1987": [24, 49], "1988": 4, "199": [27, 49], "1991": 49, "1992": [4, 23], "1995": 14, "1996": 24, "19965825": 40, "1997": 23, "1998": [5, 21], "1999": 21, "19d": 49, "1_contig_1": 2, "1_contig_2": 2, "1a": 14, "1b": 14, "1b9e77": 7, "1d": 49, "1donor": 10, "1e": [3, 27], "1e4": [17, 19, 25], "1e6": [14, 19], "1f4": 2, "1i": 49, "1l": 11, "1leiden": 10, "1log_total_fragment_count": 10, "1m": 10, "1mb": [2, 4], "1min": 15, "1nuc_signal_filt": 10, "1nucleosome_sign": 10, "1sampl": 10, "1site": 10, "1total_fragment_count": 10, "1tss_score": 10, "2": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "20": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 34, 36, 37, 38, 40, 42, 44, 45, 49, 50, 51], "200": [2, 3, 4, 8, 11, 13, 14, 15, 19, 25, 27, 28, 38, 41, 49], "2000": [7, 11, 13, 19, 21, 23, 32, 49, 51], "20000": [7, 13, 16, 27, 48], "200000": 28, "2000000": 11, "2000x100": 21, "2001": 49, "2002": [1, 50], "2003": 13, "20031921": 40, "2004": 15, "2005": [15, 21, 24], "2006": [2, 4, 21], "2007": [7, 15, 23, 24], "2008": [6, 15], "2009": 49, "200e": 40, "200px": 42, "201": [13, 24, 27, 28], "2010": [13, 14, 17, 24, 40, 49], "201004e": 14, "2011": [15, 21, 24, 50, 51], "2012": [7, 8, 17, 21, 24], "2013": [1, 2, 7, 15, 17, 23, 49], "2014": [1, 13, 14, 23, 24, 31, 49], "2015": [1, 7, 14, 15, 19, 22, 23, 24, 26, 49, 50], "2016": [1, 2, 5, 6, 7, 14, 15, 17, 21, 23, 24, 30, 48, 49, 50], "2017": [1, 3, 4, 7, 8, 13, 14, 15, 16, 17, 21, 22, 23, 24, 26, 30, 37, 47, 48, 49, 50], "20171": 34, "2018": [1, 2, 4, 5, 6, 7, 14, 15, 16, 19, 21, 23, 24, 25, 26, 41, 44, 47, 49, 50, 51], "20188746": [7, 14, 22], "2019": [1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 22, 23, 24, 25, 26, 31, 32, 38, 43, 44, 49, 50, 51], "202": [2, 13, 27, 28], "2020": [1, 2, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 28, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "20209620": 7, "2021": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "20210110": 1, "202105932": 48, "202110282": [50, 51], "202110798": 29, "2022": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 27, 28, 29, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "20220323_neurips21_bmmc_christoph": 10, "20220607": 2, "20220607t163052z": 2, "20220607t163055z": 2, "2023": [5, 9, 21, 25, 27, 30, 33, 39, 41, 44], "202427": 13, "2025": [4, 25, 50], "20267766": 40, "2027": 21, "20274924909862": 37, "203": [16, 19, 23, 27], "2031": 21, "203162": 41, "2032": 25, "204": 13, "20407": 17, "2049": 13, "205": [7, 13], "205217": 15, "206": [13, 48], "207": 27, "20729": 16, "2075": 28, "2076": 28, "208": [7, 13], "20801": 51, "209": [13, 48, 49], "2099": 47, "20antibodi": 4, "20bind": 4, "20px": 42, "20sequenc": 4, "21": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50, 51], "210": 13, "2100293118": 13, "21038": 14, "2105": 17, "2105859118": 51, "2105932": 48, "210719": 3, "211": 13, "211152": 17, "212": 24, "21246": 25, "213": [13, 27], "2135": 2, "21361": 11, "213795": 25, "214": 23, "215": [13, 27], "21583": 9, "216": 27, "2164": 17, "217": [13, 27], "217131": 14, "217223": 17, "21737": 48, "218": [2, 25, 49], "2184484": 48, "219": 49, "219184": 14, "21a": 25, "21b": 25, "21g": 49, "21m": 21, "22": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "220": [1, 39, 41, 49], "2202": 4, "220291": 10, "2207": 51, "221": 13, "2211": 5, "22155762": 40, "222": 27, "222037": 17, "2224": 13, "22256": 11, "223": [5, 27], "2234": 5, "224": [13, 14, 16, 26, 27, 44, 49], "2247": 5, "224m": 21, "225": 27, "225355": 3, "226": 28, "226039e": 7, "227": [25, 32, 33, 34, 48], "22714": 17, "228218e": 25, "22864": 13, "22906494140625": 37, "22969": 5, "22m": 21, "22mremov": 10, "23": [1, 2, 4, 5, 7, 8, 9, 13, 15, 17, 19, 21, 23, 24, 25, 27, 28, 39, 49], "230": 49, "23030": 6, "230531": 17, "230862e": 41, "230863": 25, "2310": 49, "2314": 49, "232": 27, "233": 27, "233993": 13, "234": 2, "234926e": 41, "235": [13, 17, 27], "235651": 17, "2356902356902357": 49, "2358": 14, "236": 27, "236452": 17, "236m": 2, "237": [24, 27], "2370": 4, "237082a0": 24, "237107": 17, "2372": 41, "23741063674291": 8, "2376": 41, "2378": 50, "237845": 17, "238": [7, 27], "239": [24, 27], "2392": 5, "239855e": 7, "23m": 21, "24": [1, 2, 4, 7, 8, 13, 14, 15, 17, 21, 24, 25, 26, 27, 28, 40, 48], "2402": 5, "240406e": 7, "241": [11, 15, 27], "24136": 27, "241950": 17, "241m": 21, "242": [1, 13, 27], "243": 27, "24326": 28, "243280": 17, "243787": 16, "243827": 38, "244": [15, 27, 49], "245": [13, 27, 48], "245327": 17, "24562": 14, "2462": 48, "246727": 17, "24673": [14, 15, 16], "247": [2, 17, 26, 27], "247085830": 2, "247920321": 7, "24807643": [47, 48], "2481": 14, "248421": 7, "24885": 4, "248959": 13, "249": [1, 7, 26, 27], "249159e": 14, "24it": [5, 19], "24m": 21, "25": [1, 2, 3, 6, 7, 8, 11, 13, 16, 17, 21, 24, 25, 27, 28, 38, 49], "250": [8, 15, 36, 37], "2500": [24, 36], "250160": 2, "251": 27, "25145999": 2, "2517": [13, 14], "251817e": 41, "252": 11, "2526": 21, "252930": 16, "253": [13, 24], "25352": 7, "2536": 11, "254": 4, "255": [13, 14], "255650623": 10, "2557408": 40, "25581122": 14, "2561": 17, "2562": 21, "257": [13, 27], "257408": 17, "2579": 41, "258": 27, "2584": 41, "258447": 47, "259": [1, 26], "25914": 2, "25957": 5, "25960": [14, 16], "2599": 14, "25k": [15, 25], "25m": 21, "25mb": 19, "26": [1, 2, 4, 7, 8, 13, 14, 16, 17, 19, 21, 23, 25, 27, 28, 40, 49], "260": 13, "261": 14, "2610": 49, "2617": 11, "2618": [13, 49], "2619": 4, "262": 1, "263": [7, 13], "26346801": 14, "264388": 17, "2644": 41, "2650": 41, "2651": 16, "265281": 25, "266": 24, "266164e": 14, "267": [13, 28], "267453": 25, "267814": 17, "26807": 17, "2685": 49, "268634": 47, "2688": [37, 41], "268886e": 15, "268972": 7, "2691": 17, "2692": 17, "269375": 7, "27": [1, 2, 4, 7, 8, 9, 10, 13, 14, 15, 21, 23, 25, 27, 36, 41, 49, 50], "270": 7, "2700": [19, 24], "270360": 41, "27085": 27, "271": [11, 38], "271008": 47, "2713": 49, "27150": 13, "271908": 23, "272": [27, 28], "2725": 11, "272807": 25, "273": 27, "2739": 5, "2742": 24, "275073": 17, "2755": 5, "2756": 11, "2757": 24, "276": [6, 13, 34], "27623436": 40, "276946": 17, "277122": 17, "2772": [23, 24], "27730927": 40, "27754053": 40, "277846": 15, "2778550400565002932400685513": 10, "278": [4, 14], "278267": 25, "2785": 26, "278576": 17, "27876": 50, "279": 13, "27998": 51, "27m": 21, "28": [1, 5, 7, 8, 9, 13, 14, 15, 16, 21, 25, 27, 28, 49, 50], "280": 40, "280023": 2, "280045": 2, "280e": 40, "281": [7, 13, 23, 50], "2810455o05rik": 41, "281529": 17, "2817": [13, 41], "281896": 17, "282": [11, 27, 28], "282002e": 15, "28213058": 40, "283": 13, "2836": 41, "284248": 17, "285": [7, 13], "285010": 7, "2858": 34, "286": 13, "28601": 21, "28692": 38, "287": 27, "2870": 47, "2874409": 48, "2878": 47, "288": 27, "289": 14, "28914454": 40, "289806": 14, "28it": 1, "28m": 21, "29": [1, 2, 7, 8, 9, 13, 15, 21, 23, 26, 27, 40, 47, 48], "290": 13, "29046": 36, "290e": 40, "291": 23, "291166": 3, "2916": 17, "292168": 13, "2924": 4, "292459e": 14, "2928460": 37, "2929": 4, "292929": 17, "293": [28, 49], "29356": 47, "294": 49, "2945": 4, "294886": 17, "295": [32, 49], "29505": 21, "2953": 15, "296": [13, 47], "2961": 15, "29645": 11, "296477site4donor8s4d810": 10, "296494": 13, "296701": 7, "297": [13, 50], "297617e": 15, "29768401": 40, "298131": 17, "29it": 4, "29m": 21, "2a05": 2, "2c": 23, "2d": [6, 7, 31, 36, 49, 51], "2d2": 23, "2e1": 49, "2e3bd02": 7, "2fgiac001": 23, "2fgigasci": 23, "2fj": 34, "2fs13059": [23, 48], "2fs41467": 14, "2g": 49, "2hg": [10, 11, 36], "2m": 4, "2nd": 15, "2x": 23, "3": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "30": [1, 2, 3, 4, 5, 6, 7, 8, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 32, 36, 37, 44, 49, 50], "300": [13, 14, 24], "3000": [11, 13, 24], "30000": 36, "300bp": 49, "300e": 40, "301": [23, 30, 34], "30169": 30, "3017": 14, "302": 2, "303": [13, 14], "3031588044": 49, "3033": 13, "303346e": 7, "3038": 11, "304042": 25, "304513": 13, "30472155": 40, "305": 13, "30508": 11, "30545": 51, "306": [13, 49], "307137e": 17, "30755": 25, "308": 25, "309": 4, "3092": 13, "3094": 23, "30992": [17, 26], "30m": 21, "31": [1, 2, 7, 8, 9, 13, 14, 15, 21, 23, 25, 27, 28, 33, 37, 40], "3100": 23, "311": 13, "311184": 36, "311677": 47, "311795e": 15, "312": [2, 28], "3120": 24, "31208": 5, "3125057": 40, "312797": 14, "313": 13, "313244": 13, "313440e": 17, "31369": 25, "314": 40, "3158": 14, "316": [23, 51], "3167": 37, "3168": 21, "317005": 11, "3175": 21, "318": 25, "3180": 17, "318167e": 7, "3192": 7, "31m": 21, "32": [1, 4, 7, 8, 13, 15, 16, 21, 23, 25, 27, 28], "3211": 13, "3212": 2, "321325e": 17, "322": [16, 23, 51], "3224": 25, "322763": 17, "32340": 27, "32401": 11, "3243": 14, "325": 10, "3251": 14, "3252": [19, 22], "325301": 17, "3255": 17, "32614": 14, "326969953": 10, "327": 50, "327003": 14, "32738": 19, "328": 4, "329": [13, 23], "32it": 1, "32m": 3, "33": [2, 4, 7, 8, 13, 15, 21, 27, 28, 30], "330": 40, "33088": 11, "331": [13, 16, 50], "33182": 41, "332": 16, "333": [13, 22], "333960": 13, "334": 4, "334078": 3, "33417": 17, "3349": 48, "3350": 4, "335187": 13, "33537": 27, "33541649": 40, "3356": [1, 2], "3358": [1, 13], "33604029": 14, "336171123": 10, "3367200": 2, "337": [14, 23], "338": [13, 48], "33856246": 38, "3389": [13, 23, 31], "339": [13, 22, 25, 48, 49], "3397624": 4, "33it": 4, "34": [2, 5, 6, 7, 8, 13, 15, 16, 21, 23, 25, 27, 28, 40, 47, 50], "340": [28, 48], "341": 16, "34106034": 40, "342": 13, "3420": 14, "342947": 13, "343": [41, 49], "343444": 17, "34369": 11, "344": 49, "34406673": 40, "3441": 4, "34464122": [15, 25], "345": 13, "34500357": 40, "3451": 21, "345130": 36, "345536": 14, "34560298": 19, "346": [17, 38, 41], "3464": 11, "34650092": 40, "34784232": 40, "348292e": 25, "348982": 13, "349": 4, "349605e": 15, "34e": 27, "34minfo": [5, 7, 16, 27, 28], "34p13": 19, "35": [1, 7, 8, 13, 14, 17, 23, 38, 40, 48, 49], "350": [8, 47], "3500": [1, 11], "350px": 42, "351": 28, "35136": 11, "3514": 13, "352": 49, "35233771": 15, "352e": 40, "353": 49, "35519": 14, "35574338": [2, 3], "35574539": 2, "355897": 3, "356": 25, "356206e": 7, "35636122": 40, "3566": 1, "357123": 13, "3573": [5, 27, 28], "3574": 1, "357973": 7, "358": 1, "3587": [5, 27, 28], "358946": 14, "359": 13, "359175783": 10, "35it": 25, "35m": 5, "36": [1, 2, 4, 8, 13, 14, 15, 16, 19, 21, 23, 24, 25, 28, 34, 36, 40, 49], "360": [13, 17], "3602": 11, "360854": 17, "360e": 40, "361": 49, "361088": 41, "362": 49, "362298e": 7, "362718": 41, "36357782": 40, "364": 25, "364741": 25, "365": 17, "36601": [10, 11, 34, 36, 44, 45, 46, 47, 48], "3665": 25, "367": [13, 16, 49, 50], "36741": [44, 45, 46, 47, 48], "367791": 13, "367997": 14, "368": 49, "369": 27, "3696": 51, "36970": 11, "36m10": 7, "37": [4, 7, 8, 13, 14, 15, 17, 23, 25, 27, 28, 37, 41, 50], "370": 24, "3709": 14, "371": [13, 49], "3711": [5, 6, 50], "372": 49, "37223306": 7, "3724_nt_t1": 49, "373": 13, "373613": 9, "373613v1": 9, "373670": 2, "374182": 25, "37445824": 40, "37460975": 40, "376": [5, 49], "376129": 15, "377": 13, "378": 14, "378736": 15, "37884": 11, "37998836": 36, "37it": 11, "37m": 21, "38": [2, 8, 13, 14, 15, 21, 24, 25, 28, 37, 49, 50, 51], "381": [24, 27], "382": 13, "38252823": 40, "3828": 14, "382e": 40, "383": 5, "3836": 16, "383709e": 41, "38390625": 37, "384": 21, "38442071": 40, "386294": 19, "386635": 7, "387": 24, "38725173": 40, "3873": 16, "388247": 14, "388413": 16, "3893": 11, "38m": 21, "39": [1, 2, 7, 8, 9, 13, 14, 15, 16, 17, 21, 23, 24, 25, 40, 44, 48, 49, 50, 51], "390": 17, "391": 13, "3914": 8, "392": [5, 7, 36], "393": 2, "3930": 7, "39347357": 36, "39347573": 36, "39360836": 38, "39360860": 38, "394": 13, "395": [4, 49], "39546196": [34, 48], "39546217": [34, 48], "3965a3": 42, "397": [2, 4, 8, 9, 15], "3971": 50, "3973": 48, "39758871": 40, "397878": 17, "399583": 16, "3998": 5, "39it": 3, "3_4": 7, "3col": 23, "3d": [31, 42, 49], "3k": [13, 19], "3m": 23, "3m2d4m": 23, "3rd": [7, 15], "4": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50], "40": [2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 19, 21, 24, 25, 27, 28, 36, 37, 38, 40, 49], "400": [7, 8, 9, 13, 14, 27, 28], "4000": [5, 7, 13, 15, 19, 27, 28, 32], "40000": 19, "40002": 28, "4000e": [27, 28], "40014331": 33, "40015741": 32, "40016014": 31, "400685513": 10, "400895": 13, "400e": 40, "400px": 42, "401": [27, 49], "401688e": 14, "4018683433533": 8, "402": [4, 11, 36], "402237": 17, "4025": 24, "402974": 25, "403": [9, 13], "403206": 47, "403485": 17, "403998": 13, "404": 13, "404424": 38, "405": 13, "405550": 25, "4056": 7, "406": 49, "4064": 4, "406509": 13, "406510": 16, "4068": 4, "40694372": 40, "4078": 1, "4081": 21, "40864": 38, "40871581": 40, "408890": 15, "409": 17, "4091": 7, "4096": 7, "4098": 13, "41": [3, 7, 8, 13, 25, 27, 28, 36], "410": 49, "410341e": 14, "410380e": 15, "410451e": 41, "411": [9, 21], "41213846": 40, "413005": 36, "4136": [27, 28], "413699": 7, "41376264": 5, "413772": 7, "414": 13, "41436645": 5, "41436648": 5, "41436666": 5, "41452287": 48, "41452308": 48, "41452434": [44, 45], "41452443": 46, "41452449": 47, "414776": 25, "415831e": 25, "416": 13, "41663": 36, "416844": 13, "4169": 16, "41695": [5, 6, 50], "418028": 14, "418293": 28, "4186": 27, "4187": 25, "419": [4, 50], "42": [2, 8, 13, 15, 17, 19, 21, 28, 40, 44], "420": 15, "420527": 28, "42056733": 40, "420668": 14, "42070949": 40, "42082271": 40, "421": [13, 44], "422": 7, "4220": [7, 24, 26, 27], "42242154": 17, "4227": 21, "423": [13, 50], "424174e": 14, "42494": 21, "425": [2, 49], "42569008": 48, "42569026": 48, "42569866": 43, "4258425": 40, "4259": 24, "4263": 25, "4265": 25, "427": [2, 49], "4272": 49, "4279": [7, 26], "427982e": 17, "4288": 49, "4292": 14, "429285": 14, "4295": 13, "43": [2, 4, 7, 8, 14, 15, 25, 27, 28, 40, 44, 49, 50], "430346": 41, "430966": 3, "431": 13, "432": [4, 13], "4325": [7, 26], "435": 21, "4354": 13, "436": 14, "436180": 13, "436426e": 17, "4380": [16, 47, 48, 50], "439": [13, 21], "44": [2, 4, 8, 11, 13, 21, 25, 27, 28, 44], "44002": 28, "4400e": 27, "440105": 13, "440e": 40, "4412": 25, "441362": 7, "441434": 3, "4421212": 40, "4427": 1, "443": [2, 13, 41, 49], "443255": 13, "44368289": 40, "4437": 7, "4443991184234619": 37, "44491": 3, "4450": 1, "446": 11, "446441": 17, "446902": 41, "447348": 17, "449": 13, "44m": 21, "45": [2, 7, 8, 13, 15, 16, 25, 27, 28, 40, 44, 50], "450": 8, "450e": 40, "451": [2, 11, 50], "452041e": 17, "45266": 2, "453": 13, "453021e": 41, "454": 24, "454514": 23, "45452260": 7, "454545": 13, "454901e": 7, "455069": 49, "456499": [19, 29], "45654": 3, "4566": 4, "457057": 28, "457491": 7, "457824": 25, "45918": 21, "46": [2, 3, 4, 7, 13, 15, 25, 27, 28, 44], "460": 50, "4612": 14, "461982": 49, "462134": 41, "46317761": 40, "4636": 41, "466": [4, 11], "466045": 41, "4665090": 37, "466587": 25, "467": 24, "467676": 13, "46780626": 40, "46793569": 40, "468": 25, "468194": 14, "468524": 14, "469": 49, "46it": 4, "46tf": 8, "47": [2, 8, 9, 13, 15, 25, 38, 44], "4700539": 40, "4710": 17, "4720": 1, "4721": 1, "473": 49, "473007": 19, "4732440d04rik": 41, "4734": 1, "4735": 1, "4736": 1, "4737": 1, "4741": 1, "474933": 50, "475": 13, "475259": 15, "476224": 8, "4764": 11, "476694e": 41, "476942": 7, "4772": 50, "4776": 41, "47760796546936035": 37, "477612": 13, "478": 7, "478744": 13, "478789e": 41, "478816": 25, "479": [16, 24], "479209": 25, "4795056255239651957255650623": 10, "479982": 25, "47e": 28, "47m": 21, "48": [1, 13, 16, 21, 26, 27, 38, 44], "480": 13, "4804": 48, "480662": 14, "481": 23, "481684": 27, "4817": [2, 19], "4818": [2, 19], "481913": 7, "483747": [7, 50], "485": 2, "48550": [5, 50, 51], "485521": 7, "48577": 21, "486": 50, "486142": 25, "487": 23, "487975": 7, "488585": 7, "488960": 9, "488960v1": 9, "489449": 23, "4895": [7, 26], "489989": [47, 48], "49": [7, 8, 10, 13, 15, 17, 25, 27, 28, 36, 44, 50], "490": 50, "490241": 5, "490536": [9, 28], "490536v1": 9, "490m": 21, "491": 23, "491204": 13, "49172687": 40, "492": [13, 48], "492298e": 41, "493646": 14, "494": [50, 51], "494025": 7, "494067": 25, "494717": 51, "494849": 40, "495": 7, "496": [2, 13, 23], "497166": 28, "4975": 28, "498": [50, 51], "498070": 17, "499": [2, 3, 23, 24, 48], "499381": 51, "49d": 49, "49i": 49, "49m": 21, "49mb": 49, "4m": 50, "4mb": 2, "4th": [15, 49], "5": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 51], "50": [1, 2, 3, 5, 8, 9, 11, 13, 15, 16, 17, 19, 21, 26, 27, 28, 31, 36, 37, 38, 40, 44, 45, 49, 50], "500": [5, 15, 19, 25, 26, 28, 32, 37, 38], "5000": [8, 17, 24], "5001": 8, "50081508": 40, "500e": 40, "501": 44, "501761": 25, "502": [7, 23], "503709": 51, "504": [13, 49], "50406265258789": 37, "504975e": 15, "504x504": 49, "505241": 50, "505243": 50, "506": 21, "507": 16, "507059": 25, "5076": 16, "508343e": 17, "5085": 16, "5088": 4, "5090": 21, "509375": 37, "5095": 17, "50it": 4, "50m": 21, "51": [1, 2, 8, 13, 15, 16, 27, 28, 44], "510": 44, "5102": 17, "5105": 4, "510513": 16, "511184": 17, "511733": 25, "511785": 3, "511875e": 15, "5119975805282593": 37, "512": [2, 13], "5122": 2, "512274": 41, "512525": 36, "512619": 16, "513303": 36, "513436": 28, "514": 13, "5150": 1, "517": [13, 36], "517788e": 15, "519": 37, "5191": 41, "519376": 13, "519725": 25, "51it": 36, "52": [1, 2, 13, 15, 25, 27, 28, 43, 44], "520368": 7, "5209": 4, "521329site4donor8s4d84": 10, "521436": 21, "5219": [27, 28], "522": 16, "52229328": 40, "523": 50, "5233": [5, 6], "524": [13, 24, 47], "525": 23, "526": [13, 36], "526175": 16, "526785": 7, "526812": 13, "527": 23, "527143": 16, "5281": [2, 3], "529": [16, 51], "52983503": 40, "52e": 16, "52it": 1, "53": [1, 5, 7, 8, 9, 11, 13, 15, 16, 27, 28], "530": 49, "531540": 15, "532": 13, "53203586": 40, "5325": 4, "5326": 21, "53420802": 40, "53496568": 40, "535": 48, "5350": 24, "535313e": 15, "535377e": 17, "53570662": 40, "535749e": 14, "535838": 15, "5362": 17, "537": 16, "537850": 7, "5387": 4, "539": 13, "53it": 1, "54": [1, 2, 3, 7, 11, 13, 15, 25, 27, 49], "540": 25, "540272": 16, "541": 49, "5416": 31, "541763": 25, "54187862": 40, "542": 27, "5421812": 25, "543": 49, "5430": 4, "544": 40, "54457": 3, "54475788": 40, "5458": 13, "546": [7, 27], "5468": 6, "547": [3, 4, 13, 25], "547428": 13, "547630": 2, "548": [13, 27], "5488": 41, "549083": 21, "54d": 49, "54it": 13, "55": [2, 4, 5, 8, 13, 15, 25, 27, 28, 37, 40, 44, 48], "550": [14, 48], "55077944": 40, "551": [13, 22], "552114": 16, "5527279": 9, "553": 1, "553531": 41, "553709": 13, "554": 1, "5550": 49, "555215": 10, "5552150": 10, "555236e": 15, "555469": 7, "555549": 25, "555775": 7, "556": [17, 49], "5560": 16, "556232": 7, "556985e": 41, "5575": 4, "557630": 16, "55767703": 40, "5581": 27, "558166": 13, "559": [7, 13], "559358e": 7, "55it": 36, "55mu": 36, "55um": 39, "56": [1, 5, 7, 13, 15, 21, 25, 31, 32, 33, 34, 40, 43, 44, 45, 46, 47, 48, 49, 50], "560": [23, 50, 51], "560000": 16, "5603": 41, "560875": 7, "561": 13, "561817e": 15, "562": 14, "562213": 25, "563": [2, 24], "564": [2, 13, 49], "564695": 16, "5647": 7, "565": [2, 14, 36], "565189": 3, "565442": 3, "566": [2, 13, 23, 49], "566315": 28, "566431": 13, "566888": 28, "5678": [13, 16], "5683": 4, "569": 7, "56904737": 40, "5692": [14, 16], "5696": 14, "5697": 16, "57": [1, 4, 8, 11, 14, 15, 21, 34, 40, 44], "570": 49, "5703": 41, "570953": 7, "571": [13, 14, 17, 50], "571231": 7, "571484375": 37, "571902e": 17, "572272": 14, "573": [2, 13], "573147": 47, "573561": 38, "574": 2, "57481": 43, "575": 49, "575714": 16, "576": 13, "578": [13, 14, 17, 49], "5780": 50, "578837907": 37, "579": [2, 17], "58": [4, 7, 8, 13, 21, 23, 25, 27, 28, 44], "580": 13, "580000": 16, "580189": 21, "580645": 49, "58097471": 40, "581": 47, "581210": 21, "581859": 3, "5828295": 40, "582m": 21, "583756": 21, "584": [7, 49], "5843360424041748": 37, "5847462": 49, "586": 13, "587": 7, "587059": 16, "587789": 16, "587934": 7, "587953": 15, "588481": 16, "588583": 14, "589": 13, "5890": 5, "5893556": 4, "58m": 19, "59": [1, 2, 6, 8, 15, 21, 25, 27, 50], "590": 7, "591230": 16, "591423": 13, "592619": 16, "592979": 25, "593": 13, "59374816": 40, "594": 21, "595822": 28, "596": 13, "596787": 14, "597": 13, "597106e": 14, "598": [13, 27, 50], "598050": 16, "598994": 13, "599": [21, 49], "5991668": 40, "59e": 36, "5d": 49, "5k": [36, 49], "5tukhkyz8kfr0000": 50, "6": [1, 2, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 21, 22, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 42, 44, 49, 50, 51], "60": [2, 4, 7, 8, 13, 21, 25, 27, 37], "600": [3, 13, 21, 25, 26], "6000": 7, "600434e": 7, "60055": 4, "600587": 13, "600777site4donor8s4d83": 10, "601": [4, 13, 34], "601172": 16, "601183": 14, "601672e": 41, "602": 21, "60339076": 40, "603415": 26, "604": [5, 43], "604138": 25, "6041789": 40, "604396": 21, "6047": 5, "605": 21, "607": 25, "608": [36, 49, 50], "608087e": 7, "609": 21, "609438": 19, "61": [8, 15, 16, 21, 25, 27, 28, 40], "610": [17, 21], "6100": 28, "610330": 16, "6111": [7, 26, 27], "611682": 3, "6127": 49, "613": [8, 21], "613233": 7, "614": 13, "614335": 4, "614805": 21, "61496228": 7, "615": 13, "6161": [13, 14], "61634144": 40, "616984": 16, "617": 13, "617856": 25, "618": [13, 21], "6181": 4, "619": 13, "6190": [4, 49], "6191": 4, "62": [1, 2, 7, 37, 51], "62002": 21, "62040415": 40, "62114": 21, "622": 21, "6224": [7, 8, 26], "622425": 8, "622430": 8, "622540": 16, "62254826": 40, "622731": 25, "623923": 16, "624": 4, "624770": 15, "624898": 16, "625": 13, "625245": 4, "625692": 16, "626": [2, 8], "626247": 16, "627": 13, "6278": 17, "6282": 49, "628266": 15, "628780e": 14, "629": 13, "629516": 4, "6298": 49, "62it": [1, 4], "62m": 21, "63": [2, 3, 8, 13, 15, 25, 27, 28, 40], "630593": 16, "63068773": 40, "63097371": 40, "631": 24, "632": [17, 27], "633906": 16, "634": [13, 27], "634978": 13, "635": [2, 27], "635792": 4, "636": [13, 27], "6366": 1, "637": [2, 13, 31], "6379": 21, "63m": 21, "64": [1, 7, 8, 13, 15, 23, 25, 27, 28, 40, 49], "640": 31, "640373": 14, "6405": 49, "641": 27, "641251e": 17, "6413": 49, "6417569358653972565359175783": 10, "6424": 49, "642700": 16, "643": [24, 27], "644": 2, "644404": 25, "64480": 21, "645": 13, "6453755": 43, "645837": 7, "646": 2, "64661": 3, "646936": 31, "647": 27, "6473": 16, "6479": 49, "648": 7, "6482": 50, "6483": 48, "649724": 13, "64bit": [7, 15, 21], "64e": 28, "65": [2, 7, 8, 15, 24, 37], "651": 13, "651011e": 15, "652": 13, "653": [5, 14], "653187e": 7, "6532": 49, "6535": 49, "6538": 49, "654": 13, "654201": 14, "6542056ns_pass": 10, "656202": 16, "656979e": 14, "657050": 14, "658": [13, 49], "6586": 41, "6587": 41, "658766": 25, "6588": 41, "6589": 41, "659": [27, 44], "6590": 41, "65903": 21, "6590886": 40, "6591": 41, "65912586": 40, "6592": 41, "6593": 41, "6594": [5, 41], "65e": 28, "66": [2, 8, 13, 25], "660366": 23, "661": 36, "661643e": 7, "662": [14, 27, 36, 38], "662003": 3, "663": [13, 15, 36], "664": 49, "6643357ns_pass": 10, "66527343749999": 37, "666": 11, "667": [4, 27], "668": 27, "668338": 7, "668948": 28, "669": 27, "669376": 16, "669951": 14, "66it": 4, "67": [7, 8, 11, 13, 15, 25, 27, 28, 40], "670": [36, 38], "670147e": 14, "670412": 13, "671": [27, 36], "6722": 4, "672811": 49, "673": [4, 5], "673299": 16, "673419": 41, "673512": 41, "673902": 4, "674": [8, 27], "6740": [7, 26], "674505": 16, "674579": 13, "674640": 14, "675": 7, "67513": 23, "676": 27, "676061e": 17, "676270": 7, "677": 27, "677266": 14, "678": 40, "6781": [7, 26], "6789298ns_pass12": 10, "68": [27, 41, 49], "680173": 43, "681": 13, "681318287535559": 3, "682": 44, "6828": 1, "683484": 26, "684": 13, "684446": 41, "684545": 41, "6848676": 40, "685439": 4, "6876": 13, "6879": 21, "688720703125": 37, "689176site4donor8s4d86": 10, "689503e": 14, "68m": 21, "69": [7, 8, 26, 27], "690": 49, "690300": 13, "690730": 25, "691": 47, "69249": [7, 26, 27, 28], "692666": 48, "693147": 19, "693653": 13, "694572": 38, "696119": 13, "696759": 14, "697710": 7, "6982": 2, "699": [13, 23], "69d": 2, "6a10": 2, "6h": [14, 16], "6th": 49, "7": [1, 2, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "70": [2, 4, 8, 13, 15, 24, 25, 27, 28, 33, 37, 40, 48, 49], "700": [24, 30, 49], "700e": 40, "701555": 15, "702486": 14, "703": [14, 27], "703306": 13, "703607": 15, "704322": 10, "7043220": 10, "704363": 7, "706": [17, 23, 47], "707": 13, "7074291": 25, "709": [13, 27], "709340": 7, "709836": 14, "71": [1, 8, 25, 40], "710": 27, "710743e": 15, "71087": 21, "710956": 14, "711": 14, "711311e": 7, "712": 13, "71216796875": 37, "712952": 13, "713": [13, 14], "714": [4, 49], "715": [7, 16, 17], "716": 13, "716018": 7, "716935": 7, "718": 49, "718796": 21, "71b2": 2, "71it": 49, "72": [2, 13, 24, 27, 40], "720537": 13, "720e": 40, "721": [7, 13, 16], "721757": 7, "721817": 15, "72449982": 40, "7246": 11, "7247": 9, "7261": 9, "727155": 13, "727261": 28, "728": [3, 9, 13], "7285": 24, "729": 13, "7290": 24, "729036": 28, "72e": 13, "72it": 11, "73": [8, 13, 24, 25, 27, 28], "730": 25, "730018e": 14, "732": 7, "73202": 48, "732079": 15, "732197": 26, "733": [13, 50], "734": 4, "735": [4, 13, 14], "735108": 13, "735157": 16, "736": [2, 13, 25, 40], "736910": 28, "737": 24, "738": 14, "738471": 7, "739": [13, 49], "74": [13, 24, 40], "740": [9, 50], "741": 39, "741429e": 14, "742": 13, "7421": 2, "742801": 16, "743": 14, "7433689832687378": 37, "743605": 16, "743707": 16, "744": [2, 13], "744249": 16, "744932": 48, "745": 49, "746": [13, 24], "746709": 13, "747": [7, 24, 49], "7473": 2, "748": 2, "749": 13, "75": [4, 8, 11, 13, 15, 24], "750": [2, 11], "750583": 26, "751": 3, "751305": 14, "753": 25, "753417": 7, "755": 24, "756032": 16, "7561": 50, "7570b3": 7, "759": [13, 39], "7590625": 37, "76": [2, 8, 13, 25, 27, 28, 49], "760814": 41, "7612": 41, "762": 25, "76287001": 40, "763": 47, "76328672": 40, "763377": 25, "7635": 49, "7647": 49, "764977": 49, "765210e": 15, "766": [25, 36], "7661": [3, 4], "766405": 13, "766446e": 14, "7665505ns_pass": 10, "766927e": 14, "767": 25, "7680": [13, 22], "768099": 41, "769": 13, "769116": 16, "769131": 13, "7699": 49, "77": [2, 8, 13, 27, 49], "771": 27, "7719": [50, 51], "772": [13, 49], "7729": 24, "773": 17, "773420": 14, "7735": 49, "7744": 2, "7745": 23, "774925": 13, "775289": 7, "7759": 49, "776": 25, "7761": 4, "7765": 50, "777": [27, 36], "777093": 48, "778762": 13, "779": [13, 27], "7793": 49, "779699": 16, "78": [13, 24, 27, 37, 40], "780330": 16, "780933": 16, "780e": 40, "781": [25, 27], "78180094": 40, "782": [17, 27], "782599": 28, "782879": 41, "783628": 16, "784": 13, "7841": 48, "786": [13, 27, 28], "786726": 7, "786800": 16, "787": [27, 28], "787177": 13, "787879": 13, "7880": 50, "788894": 7, "78it": 4, "79": [1, 2, 8, 13, 16, 25, 27, 28, 37], "7904": 5, "791": 4, "791759": 19, "7919": 25, "7921": 49, "7924": [36, 50], "792996": 16, "793133": 14, "7937": 2, "795": 3, "79518632": 40, "795791": 48, "796": 49, "796760": 28, "797": [13, 44], "798": 27, "79949063": 40, "7fjo": 4, "7m": 49, "7te1": 4, "8": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 44, 47, 48, 49, 50, 51], "80": [4, 6, 15, 17, 19, 24, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "800": [16, 24], "8000": 24, "800875": 28, "800e": 40, "801": 25, "801417": 16, "801776e": 15, "80187795": 40, "8023": [7, 26], "803": 13, "804": 13, "804169": 47, "80491293": 7, "805": 13, "805382": 13, "806": [2, 13], "806636": 16, "806682e": 17, "806917": 7, "807": 13, "808": 13, "808672": 28, "808744": 25, "809135": 48, "80it": 4, "80m": 21, "81": [8, 23], "810": [13, 49], "811296": 13, "813": [23, 51], "814": 27, "81470655": 40, "815": [2, 27], "816508": 16, "817": 13, "817033": 16, "81758862": 40, "81768536": 40, "818": [23, 27, 51], "818029e": 25, "81m": 2, "82": [24, 25, 27, 28, 49], "822": 2, "824": [7, 27], "82483187": 40, "824921e": 14, "825716": 13, "826": 49, "826349": 16, "828": [1, 27], "828314": 48, "828461": 41, "829": 27, "829060e": 17, "83": [4, 8, 40], "830": 2, "830160e": 41, "830189": 13, "830964e": 7, "831": [25, 27], "831962": 15, "833": 27, "833656": 7, "835": [4, 27], "835072": 16, "835278": 26, "835813e": 25, "836": 25, "836198e": 15, "83673": 21, "837373e": 14, "83739543": 40, "839": 13, "83917564": 40, "83928709": 40, "8394": 21, "83it": [4, 13], "84": [2, 15, 25, 40], "840": 4, "840017e": 25, "841986": 41, "842": 13, "842074": 41, "842316": 7, "843872e": 25, "844158": 15, "84451806": 2, "844788": 10, "8447880": 10, "845": [27, 50], "845827": 3, "846": 1, "847007": 16, "847296e": 15, "847325": 28, "847772": 7, "848": 50, "849110": 41, "85": [8, 13, 15, 25, 27, 28], "850": [4, 14], "851": 13, "851652e": 41, "851992": 10, "8519920": 10, "852": [1, 7], "8520": 25, "8534": 25, "854350": 36, "854867": 28, "857": 13, "858930": 25, "859110": 7, "859812": 48, "85984283": 40, "86": [17, 36], "8600": 21, "861761": 41, "862": 27, "862745": 13, "86332": 5, "864": 38, "865": [16, 47, 48, 50], "866542": 41, "8674": [17, 26], "868": [13, 16, 47, 48, 50], "86826297": 40, "86853162": 40, "868723": 41, "869": 34, "86it": [4, 36], "87": [4, 8, 15, 27, 40], "87010332": 40, "871410e": 7, "872": [13, 40], "874753": 41, "875000": 13, "87520289": 40, "876": 13, "876626": 13, "877": 14, "877078": 14, "877567": 25, "878": 40, "8783461218238": 25, "8783489520283": 25, "8783502753003": 25, "87860": 17, "879": 13, "879454": 7, "879555": 10, "8795551": 10, "879631": 13, "87it": 4, "88": [7, 24, 25, 27, 28], "880493": 13, "88126696": 40, "882": 10, "886244": 13, "886662": 28, "887735": 7, "888": 21, "888212e": 15, "888747": 41, "888934": 16, "888983": 48, "88912876": 40, "889446": 7, "89": [3, 4, 6, 8, 14, 15, 16, 25], "89059": 21, "890983site4donor8s4d83": 10, "891": 44, "8910": 21, "89201807975769": 8, "892693": 43, "893431": 15, "894241": 15, "894277site4donor8s4d80": 10, "8946": 21, "89471": 15, "89472": 15, "89473": 15, "89474": 15, "89475": 15, "89476": 15, "89478485": 37, "897": [4, 13], "897245": 14, "89883": 17, "89m": 21, "8b": 24, "9": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "90": [1, 5, 8, 14, 23, 40, 49], "900": 24, "9000": 21, "9001": 27, "900e": 40, "901060": 7, "902": 40, "90261": [27, 28], "902793e": 17, "903": 4, "904": [1, 2, 13], "904970": 16, "905402": 7, "906": 41, "907": 13, "907165": 7, "908": 14, "908718": 13, "9088": 17, "9089": 17, "909": 13, "90907953": 40, "9091": 17, "9092": 17, "9093": 17, "9094": 17, "9095": 17, "9096": 17, "9097": 17, "9098": 17, "9099": 17, "90th": 23, "91": [8, 13, 15, 25, 26, 27, 28], "910": 13, "9100": 17, "910013e": 41, "9101": 17, "9102": 17, "9103": 17, "9104": 17, "9105": 17, "9106": 17, "910679": 28, "9107": 17, "9108": 17, "910886e": 7, "9109": 17, "911": 38, "9110": 17, "9112": 17, "9113": 17, "9114": 17, "9116": 17, "9117": 17, "9118": 17, "9119": 17, "912": 13, "9120": [17, 21], "9121": 17, "9122": 17, "9123": 17, "9124": 17, "9125": 17, "9126": 17, "9127": 17, "9128": 17, "9129": 17, "913": 13, "9130": 17, "9131": 17, "913474": 7, "914140": 28, "915237": 7, "916": [1, 2, 49], "916060": 13, "9165": 17, "9166": 17, "9167": 17, "9168": 17, "9169": 17, "9170": 17, "9171": 17, "9172": 17, "917264": 26, "918": 47, "918486": 38, "919285": 7, "9198482": 40, "92": [3, 4, 7, 40], "920183e": 14, "920476": 16, "921": 7, "921133": 14, "9223": 28, "924": 13, "924885": 14, "925": 13, "926409": 13, "927": [4, 27], "92787693": 40, "928": [14, 49], "9284": 3, "928962e": 41, "92952": 21, "929809": 38, "92m": [21, 50], "93": [3, 4, 8, 25, 37], "930": 13, "931": 38, "931002": 13, "931371": 38, "931475": 7, "932": [13, 49], "932017": 10, "9320170": 10, "933080": 13, "934": [13, 27, 34], "935": [7, 13], "935320e": 25, "935677e": 7, "936": [7, 27, 48], "93674686223055": 37, "937": [27, 38], "9370": 5, "938": 27, "938353": 13, "938400": 38, "939": [44, 48], "94": [1, 3, 4, 7, 14, 15, 16, 25, 27, 28, 49], "940": [13, 39], "941": 38, "941194": 7, "941976": 13, "942": [13, 27], "942619": 41, "943": [21, 27, 49], "943484": 14, "943768": 14, "9448": 38, "945946": 13, "9468": 4, "94699794": 40, "947": 27, "94739732": 40, "948": [13, 27], "948760": 48, "94m": 50, "95": [8, 14, 23, 27, 36, 37], "9504644ns_pass": 10, "950519": 41, "951949": 13, "952": [21, 27], "952170": 14, "9525": 30, "953": 44, "954": [13, 21], "955": 39, "957": 13, "958": 21, "95861812": 40, "959142": 21, "959439": 28, "95e": 36, "95it": 4, "95mmodel": 5, "96": [7, 13, 14, 37, 51], "960": 2, "961": 5, "964611": 15, "965": 21, "965786e": 25, "966242": 38, "966629": 14, "966640e": 15, "967249": 48, "967723": 11, "968": 13, "969": [5, 21], "969514": 7, "96it": 4, "97": [4, 5, 8, 13, 25, 27, 28, 37], "970": [13, 47], "970597": 7, "971": 13, "972292e": 7, "974": 16, "975": 8, "975838": 25, "976": [13, 21], "9763": 11, "976548": 25, "97723212": 40, "977985": 38, "978": 8, "9781420072877": 40, "979729": 41, "98": [3, 4, 5, 7, 8, 15, 21, 23, 27, 28, 49], "980": 15, "980689": 25, "981": 17, "981884": 13, "982": [21, 27], "982125": 25, "982928": 13, "982935": 25, "982940": 7, "983": [5, 17, 27], "983729": 7, "984": 13, "9842": 13, "9842x847": 13, "984389": 14, "984937": 14, "985": 13, "9852": 13, "985533": 7, "986": 5, "986854": 13, "986995": 43, "987": [8, 15], "9875": 1, "9876": [7, 26], "9880": 1, "988357": 38, "989": 27, "989366": 7, "99": [3, 8, 11, 36, 49], "9900": 21, "991": [13, 50], "991655e": 15, "992": 36, "992065": 41, "992305": 41, "992308": 41, "993": 27, "99305736": 40, "9931": 7, "994": 13, "994851": 11, "995": [11, 27], "997": 27, "9986": 17, "999": 36, "99900": 21, "9996": 13, "99976227": 8, "99982818": 1, "9999": 47, "99th": 5, "9b89970eac2a3bd770e744f63c7763419486b14c": 21, "9min": 14, "A": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 43, 45, 47, 48, 49, 50, 51], "And": [2, 5, 13, 14, 28], "As": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 34, 36, 37, 38, 39, 41, 43, 44, 45, 46, 48, 49, 50, 51], "At": [8, 13, 19, 23, 24, 26, 47, 49], "Be": [13, 15, 30], "Being": 38, "But": [0, 13, 32, 34], "By": [1, 3, 4, 7, 11, 13, 15, 16, 17, 19, 21, 25, 28, 30, 36, 39, 40, 48, 49], "For": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 33, 34, 36, 37, 38, 40, 41, 43, 44, 48, 49, 50, 51], "If": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 37, 47, 48, 49, 51], "In": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "Ines": [23, 24], "It": [0, 1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 28, 30, 31, 33, 34, 36, 41, 43, 44, 46, 49], "Its": [22, 24], "Near": 23, "No": [1, 4, 5, 7, 10, 15, 21, 23, 25, 27, 28, 36], "Not": [1, 4, 7, 31], "OFS": 23, "ONE": 24, "Of": [13, 19, 23, 36, 49], "On": [1, 3, 4, 7, 9, 14, 21, 23, 24, 25, 28, 40, 41, 48, 49, 50, 51], "One": [1, 2, 5, 7, 8, 11, 13, 16, 23, 26, 28, 36, 37, 40, 41, 48, 49, 50], "Or": [5, 25], "Such": [3, 4, 5, 15, 23, 24, 49], "That": [1, 14, 34, 49], "The": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 29, 30, 31, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50], "Their": [4, 34, 36], "Then": [8, 13, 23, 25], "There": [1, 2, 4, 5, 7, 11, 13, 15, 16, 23, 24, 27, 33, 47, 48, 49], "These": [2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 27, 30, 31, 33, 34, 36, 38, 39, 48, 49, 50, 51], "To": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 34, 36, 37, 38, 39, 40, 43, 48, 49, 50, 51], "Will": [4, 11], "With": [3, 4, 5, 9, 10, 11, 19, 23, 24, 29, 46, 48, 49], "_": [1, 2, 3, 10, 14, 15, 19, 21, 25, 27, 28, 36, 38, 41, 49], "__": 28, "____": 28, "______": 28, "__categori": 7, "__class__": 21, "__future__": 15, "_aa": 2, "_adt_cit": 27, "_align": 4, "_atac": 11, "_atac_multiom": 27, "_b": 42, "_call": 2, "_color": 7, "_complex": 25, "_core": [4, 11, 19, 21, 34], "_epoch_end": 28, "_eprint": [6, 36], "_file": 38, "_fullir": 4, "_g": 36, "_gene": 2, "_get_obs_rep": 15, "_ham": 4, "_highly_variable_gen": 7, "_index": 7, "_indic": 36, "_io": 7, "_junction": 2, "_locu": 2, "_mean": 25, "_minpack_pi": 41, "_network": 1, "_node": 13, "_nt": 2, "_overloaded_dict": 1, "_product": 2, "_prop": 25, "_prot": 27, "_r1_": 23, "_r2_": 23, "_remote_module_non_script": 5, "_rna": 27, "_rna_cit": 27, "_rna_multiom": 27, "_scvi": 7, "_scvi_batch": [7, 27, 36], "_scvi_extra_categorical_cov": [27, 36], "_scvi_label": [7, 27, 36], "_scvi_manager_uuid": [7, 27, 36], "_scvi_uuid": [7, 27, 36], "_static": 1, "_supplement": 38, "_t": 36, "_tool": [7, 25, 36], "_un": 1, "_validate_cell_df": 4, "_vj": 4, "a8d480": 42, "a_g": 36, "aa": [1, 4], "aaaaaa": 49, "aaaaaacatgt": 49, "aaaaaacgata": 49, "aaaat": 49, "aaaatgatat": 49, "aaacagccaagcttat": [10, 11], "aaacagccatagcttg": 11, "aaacagccatgaaatg": [10, 11], "aaacagccatgtttgg": [10, 11], "aaacatacatttcc": 14, "aaacataccacaac": 13, "aaacataccagaaa": 14, "aaacataccatgca": 14, "aaacatacctcgct": 14, "aaacatacctggta": 14, "aaacatgcaacgtgct": [10, 11], "aaacatgcaatatagg": [10, 11], "aaacatgcaattaacc": 10, "aaacccaaggatggct": [27, 28, 48], "aaacccaaggcctaga": [27, 28, 48], "aaacccaagtgagtgc": [27, 28, 48], "aaacccacaagaggct": [27, 28, 48], "aaacccacatcgtggc": [27, 28, 48], "aaacccacattctcta": [27, 28], "aaacccagtccgcagt": [27, 28], "aaacccagtgcatact": [27, 28], "aaacccagttgacgga": [27, 28], "aaacccatcgatactg": [27, 28], "aaacctgagaaaccta": 2, "aaacctgagaacaatc": 2, "aaacctgagaactcgg": 2, "aaacctgagaagccca": 2, "aaacctgagaaggaca": 2, "aaacctgagaataggg": 2, "aaacctgagaatgtgt": 2, "aaacctgagacactaa": 2, "aaacctgagcgatata": 2, "aaacctgtctaccaga": 2, "aaacgcacgaggac": 13, "aaacgcactagcca": 13, "aaacgcactgtccc": 13, "aaacgggcatttgctt": 2, "aaacggggtagcacga": 2, "aaacgggtcgtaccgg": 2, "aaacttgaccacct": 13, "aaagcaagtcgaaagc": 2, "aaatg": 49, "aaatggatat": 49, "aab": 28, "aacaaaggttggtact": 28, "aacgttgagctgcgaa": 2, "aactcagtcaaagtag": 2, "aactcccaggtgcaca": 2, "aactccccaagtacct": 2, "aactcttagcaccgct": 3, "aactcttcagatcgga": 2, "aactggtcagggagag": 2, "aadel": 17, "aaed1": 14, "aaf7907": 49, "aamodt": 25, "aar5780": 50, "aaron": [5, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 27, 28, 34, 48, 49, 51], "aattc": 49, "aax3072": 50, "ab": [4, 5, 6, 8, 13, 14, 15, 17, 22, 24, 29, 38, 50, 51], "aba2619": 17, "abadi": 50, "abb": 4, "abba": 23, "abbrevi": 19, "abc": 42, "abcb4": 38, "abd": 51, "abdab": 4, "abdab_200422": 4, "abdela": [5, 38], "abel": 49, "abf1356": 25, "abha": 23, "abhijeet": 9, "abi": 24, "abi1": 14, "abigail": 9, "abil": [21, 24, 38], "abind": [7, 21], "abind_1": [25, 27, 28], "abl": [0, 1, 2, 4, 5, 7, 8, 13, 14, 15, 16, 24, 25, 28, 33, 48, 50], "abl5197": 5, "abm": 25, "abnorm": [2, 24], "about": [1, 2, 3, 4, 5, 7, 8, 11, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 38, 49, 50], "abov": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 36, 40, 45, 46, 48, 49, 50, 51], "abq3745": 51, "abracl": 14, "absenc": [17, 25], "absl": 7, "absolut": [2, 7, 8, 11, 13, 14, 15, 17, 24, 34, 42], "absorb": 50, "abstract": [6, 23, 41, 49, 50], "abstractli": 6, "abund": [3, 4, 7, 14, 15, 16, 17, 23, 24, 25, 27, 28, 36, 43, 47, 48, 51], "abyzov": 49, "ac": [3, 4, 5, 11, 19], "ac002321": 19, "ac145205": 19, "ac213203": 11, "ac240274": 7, "acaccaagtcgattgt": 2, "academ": [2, 4, 9, 14, 17, 19, 25, 26, 36, 38], "academi": [1, 4, 13, 15, 24, 51], "acadvl": 14, "acaggtgctcaaatr1": 49, "acaggtgctcaaatr2": 49, "acaggtgctcaaatr3": 49, "acatcagcatactacg": 2, "acc": 13, "acc_scor": 8, "accept": [5, 7, 13, 21, 23], "access": [0, 2, 4, 5, 7, 9, 11, 16, 18, 22, 24, 26, 28, 30, 36, 38, 39, 41, 48, 49, 50], "accessor": 19, "accommod": 15, "accomod": 15, "accompani": [9, 16, 22, 29, 49], "accomplish": [24, 37], "accord": [1, 8, 11, 14, 15, 16, 18, 23, 24, 25, 26, 32, 34, 36, 38, 40, 49, 50], "accordingli": [3, 4], "account": [1, 4, 5, 6, 7, 9, 13, 14, 15, 16, 18, 19, 23, 28, 33, 36, 37, 41, 49, 50, 51], "acctgtcaggactggt": [27, 28], "accumul": [2, 49], "accur": [1, 2, 3, 4, 5, 7, 13, 14, 15, 17, 18, 23, 24, 25, 26, 30, 36, 37, 44, 49, 50, 51], "accuraci": [4, 5, 15, 16, 17, 18, 23, 24, 25, 31, 34, 36, 38, 49], "acetyl": 9, "acgcc": 49, "acgtaacaggtctact": 27, "achiev": [0, 2, 7, 15, 23, 24, 34, 36, 38, 50, 51], "achil": [7, 38], "achillesencod": 3, "acid": [1, 2, 3, 4, 7, 9, 14, 15, 18, 24, 25, 26, 36, 38, 49], "acjn21": 25, "acknowledg": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 49, 50], "acm": 50, "acot9": 14, "acquir": [1, 18, 24, 30, 49], "acr": 50, "acronym": 18, "across": [1, 3, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 38, 41, 47, 48, 49, 51], "acsm3": [5, 12], "act": [18, 21, 24, 48, 49, 50], "actatctcacaggagt": 3, "actctgctccagatr2": 49, "actctgctccagatr3": 49, "actgtcctctcggacg": 3, "actgtgaagaaattgc": 23, "action": [1, 2, 3, 16], "activ": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "activatior": 8, "active_ligand_target_link": 25, "actual": [1, 7, 13, 14, 15, 16, 19, 21, 23, 24, 25, 27, 28, 36, 41, 48], "acut": 2, "ad": [1, 2, 3, 4, 7, 10, 11, 13, 15, 16, 21, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 40, 41, 48, 51], "ad_auc_mtx": 26, "ad_g": 38, "ad_map": 38, "adam": [1, 5, 7, 9, 13, 22, 24, 25, 27, 28, 36, 43, 50, 51], "adameyko": [50, 51], "adamson": 49, "adapt": [3, 4, 5, 7, 8, 9, 11, 13, 16, 18, 23, 24, 26, 48, 50], "adaptor": 24, "adata": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 48, 50, 51], "adata2": [19, 21], "adata_": [14, 27, 28], "adata_batch": 26, "adata_batch_top_tf": 26, "adata_bbknn": 7, "adata_bc": 3, "adata_bcr": [1, 2, 3, 4], "adata_bcr_tmp": 2, "adata_beniss": 3, "adata_benisse_out": 3, "adata_both": 27, "adata_cell_pop": 14, "adata_cell_typ": 14, "adata_celltypist": 5, "adata_conga": 3, "adata_copi": 14, "adata_donor": 14, "adata_emb": 5, "adata_ergo": 4, "adata_fil": 10, "adata_hvg": 7, "adata_log": 17, "adata_manag": 36, "adata_map": 38, "adata_measur": 38, "adata_mono": 14, "adata_mvi": 28, "adata_mvtcr": 3, "adata_new": 19, "adata_pair": 28, "adata_pb": 14, "adata_pert": 16, "adata_pp": [33, 34], "adata_predict": 38, "adata_process": 49, "adata_r": 17, "adata_raw": [7, 34], "adata_repl": 14, "adata_sa": 23, "adata_sc": [36, 38], "adata_scanvi": 7, "adata_scvi": [7, 13], "adata_seurat": 7, "adata_st": [36, 38], "adata_stim": 25, "adata_subset": 19, "adata_t": 16, "adata_tc": 3, "adata_tcr": [2, 3, 4], "adata_tcr_align": 4, "adata_tcr_tmp": 2, "adata_tcrdist": 4, "adata_tcrmatch": 4, "adata_temp": 48, "adata_tessa": 3, "adata_to_map": 5, "adata_to_map_aug": 5, "adata_usa": 23, "adata_vi": 36, "adata_view": 19, "adck4": 15, "add": [1, 2, 3, 4, 5, 7, 10, 11, 13, 14, 15, 19, 27, 28, 32, 33, 34, 36, 41], "add_dist": 4, "add_dot": 13, "add_edges_from": 27, "add_level_nam": 13, "add_nhood_express": 13, "add_nodes_from": 27, "addadi": 36, "addendum": 34, "addict": 16, "addit": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 43, 48, 49, 50], "addition": [1, 2, 3, 4, 6, 7, 10, 11, 13, 14, 15, 16, 23, 24, 25, 27, 28, 30, 32, 34, 36, 37, 38, 41, 43, 48, 49, 50, 51], "addmodel": 8, "address": [13, 14, 16, 19, 21, 22, 23, 25, 28, 30, 34, 39, 47, 49], "adelman": 16, "adem": [17, 26], "aden": 49, "adenovir": 49, "adequ": 49, "adgrg1": 8, "adhes": 25, "adiconi": 24, "adipocyt": 36, "aditi": [7, 11, 27, 28, 34, 48], "adj": [26, 27, 37], "adj_2d": 37, "adj_pval": 25, "adjac": [23, 26, 36, 37, 38, 49], "adjust": [3, 4, 7, 11, 13, 14, 15, 23, 33, 36], "adjustcount": 34, "adjusttext": [1, 25], "adkin": 24, "administr": 15, "adolesc": 16, "adopt": [21, 23, 30], "adri": 24, "adrian": [1, 17, 24], "adrienn": 16, "adt": [3, 16, 28, 43, 44, 45, 46, 47, 48], "adt_cit": 27, "adt_cite_bridg": 27, "adt_cite_queri": 27, "adt_cite_query_bridg": 27, "adt_iso_count": [27, 28], "adt_isotype_control": [27, 28], "adt_n_antibodies_by_count": [27, 28], "adt_pp": 28, "adt_pseudotime_ord": [27, 28], "adt_total_count": [27, 28], "adt_x_pca": [27, 28], "adt_x_umap": [27, 28], "adult": [15, 24], "adv": 48, "advanc": [0, 2, 4, 7, 14, 15, 16, 17, 21, 23, 24, 25, 28, 30, 37, 48, 49, 50, 51], "advantag": [1, 2, 4, 5, 14, 19, 21, 23, 24, 25, 31, 39, 48, 49], "advent": 29, "advers": 15, "advic": 7, "advis": [4, 7, 16, 22, 24, 28, 33, 34, 45], "ae": [8, 16], "aebersold": 48, "aert": [8, 9, 15, 26], "aertslab": [8, 26], "aevermann": 24, "af": [23, 50], "af_quant": 23, "af_xmpl_run": 23, "afb": 49, "affect": [5, 7, 13, 14, 15, 18, 23, 24, 26, 34], "affin": [1, 2, 4, 9, 23], "afford": 24, "aforement": [5, 16, 31, 34, 45], "aftab": 9, "after": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "afterward": [1, 3, 5, 6, 11, 19, 32, 34], "ag": [2, 5, 13, 14, 17], "ag_rfc": 16, "agaaatgagtgcctcg": 28, "agaat": 49, "agahi": 49, "again": [1, 2, 4, 5, 6, 7, 13, 14, 16, 19, 21, 23, 25, 27, 28, 36, 49, 50, 51], "against": [3, 4, 7, 13, 18, 22, 25, 26, 34, 43, 51], "agami": 5, "agcaggtaggctatgt": 7, "agent": [1, 2], "agerang": 2, "agg": [5, 14, 49], "agg_dict": 14, "aggatctaggtctact": [27, 28], "agglom": 50, "aggr_donor": 10, "aggreg": [6, 8, 11, 13, 14, 16, 19, 25, 34, 37, 38, 39], "aggregate_and_filt": 14, "aggregatebiovar": 14, "aggregatefeatur": 11, "aggress": 49, "agjy21": 28, "agnieszka": 13, "agnost": 23, "agonist": 5, "agrafioti": 2, "agraw": [7, 11, 27, 28, 34, 48], "agre": [13, 26, 29], "agreement": [8, 25, 32], "agrn": 3, "agtgcggagtaagggc": 7, "aguilar": 25, "ahead": [34, 44], "aheyon": 51, "ahlmann": 33, "ahm": [5, 14, 24, 38], "ahmad": 7, "ai": 50, "aibar": [8, 9, 15, 26], "aicd": 1, "aid": [7, 8, 15, 16, 26, 51], "aidyn": 7, "aik": 24, "aim": [3, 15, 16, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 36, 38], "aime": 51, "air": 4, "air_repertoir": 1, "aird": 24, "airr": [1, 2, 3], "airwai": 49, "aisasgggssgntii": 4, "aisha": [3, 4], "aislyn": 49, "aitchison": 13, "aivazidi": 36, "akartuna": 24, "akeson": 24, "aki": 2, "akiaiycqyoyv5jssrooa": 2, "al": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "al592183": 7, "al627309": [7, 11, 36], "alain": 25, "alam": [9, 25], "alan": [14, 19, 29], "aland": 23, "albeit": 25, "albert": [30, 49], "alberto": [25, 26], "albrecht": 22, "alder": 2, "aldex2": 13, "alejandro": [7, 11, 14, 16, 19, 22, 27, 28, 34, 48, 49], "alejo": 49, "aleksandar": 24, "aleksandr": 4, "aleksandra": [1, 5, 36], "aleksandrina": 36, "alemani": 49, "alen": 5, "alessandro": [4, 50, 51], "alevin": 51, "alevin_fry_gpl": 23, "alevin_fry_hom": 23, "alevin_fry_qu": 23, "alevin_map_dir": 23, "alevinqc": 23, "alex": [7, 14, 23, 24, 25, 49], "alexand": [2, 5, 6, 7, 11, 13, 14, 16, 17, 19, 23, 24, 26, 27, 28, 31, 34, 36, 48, 49, 50, 51], "alexandr": 17, "alexandra": [7, 11, 17, 24, 27, 28, 34, 48, 50], "alexandro": 14, "alexandrov": 49, "alexei": [14, 15, 16, 43], "alexej": 49, "alexi": 7, "alfr": 17, "algorithm": [0, 2, 3, 5, 6, 8, 15, 16, 18, 19, 23, 25, 31, 37, 38, 48, 50, 51], "alhamdoosh": 14, "ali": [2, 24, 25, 36], "alic": [2, 14, 17, 49], "alicia": [7, 8, 13, 23], "alida": 51, "alie": [7, 11, 17, 27, 28, 34, 48], "align": [3, 4, 7, 9, 11, 15, 16, 18, 24, 27, 34, 36, 38, 42, 49, 50, 51], "align_burnin": 27, "alik": 3, "alina": 16, "alison": 49, "alistair": 25, "alizadeh": 17, "all": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 47, 48, 49, 50, 51], "all_tumor": 49, "all_val": 49, "allan": [23, 24], "allel": 49, "allele_rep_thresh": 49, "allele_t": 49, "allelet": 49, "allen": [5, 49], "allevi": [13, 16, 36], "allison": [3, 4, 23, 24, 25], "allissa": 17, "alloc": [8, 19, 23, 38], "allon": [5, 6, 7, 17, 23, 24, 36, 49, 50], "allow": [1, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 36, 37, 44, 45, 48, 49, 50, 51], "alltfs_hg38": [8, 26], "alma": [36, 41], "almet": 25, "almodaresi": 23, "almond": 51, "almost": [1, 7, 13, 15, 21, 23, 24, 28, 36], "alo": [4, 50, 51], "alok": 7, "alon": [14, 19, 23, 25, 26, 30, 49], "along": [9, 13, 15, 16, 18, 23, 28, 34, 36, 49, 50, 51], "alongsid": 13, "alonso": [15, 25, 26], "alper": 11, "alpha": [1, 4, 11, 13, 14, 33, 37, 38, 49, 51], "alpha_divers": [1, 3], "alpha_g": 51, "alphanumer": [10, 21, 23], "alreadi": [1, 2, 3, 4, 5, 6, 7, 11, 14, 17, 19, 21, 23, 24, 26, 31, 32, 33, 36, 37, 38, 43, 45, 48, 49, 50, 51], "also": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 45, 46, 47, 48, 49, 50, 51], "alt": 5, "alt_var": 36, "alter": [23, 25], "altern": [1, 2, 4, 5, 11, 13, 15, 16, 19, 21, 23, 24, 25, 26, 28, 36, 39, 49], "altexpnam": [7, 21], "although": [1, 5, 7, 13, 14, 15, 19, 21, 23, 24, 25, 30, 34, 43, 50, 51], "alunni": 51, "alv": 25, "alvarez": 23, "alvaro": 3, "alveolar": 5, "alwai": [5, 7, 8, 13, 15, 16, 19, 21, 22, 24, 29, 33, 43, 49], "alzheim": 51, "amalia": 29, "aman": 38, "amanda": [5, 15, 17, 24, 49, 50], "amaz": 49, "amazonaw": 2, "amb17": 1, "amber": 2, "ambient": [23, 33, 47, 48], "ambigu": [2, 4, 23], "ambridg": 50, "ambros": 23, "amedeo": 17, "amelia": [37, 41], "american": 49, "amezquita": 22, "ami": [24, 49], "amino": [1, 2, 3, 4, 18, 24], "aminoacid": 1, "amir": [9, 13, 14], "amiri": 7, "amit": [2, 17, 23, 24, 36, 50, 51], "ammar": 29, "amnon": 13, "amodio": 16, "among": [3, 5, 7, 13, 14, 15, 16, 23, 25, 26, 36, 39, 49], "amongst": 49, "amount": [0, 1, 2, 3, 4, 5, 7, 13, 14, 18, 24, 26, 29, 31, 34, 48], "amp": 50, "amplicon": [13, 49], "amplif": [18, 23, 24], "amplifi": [9, 13, 18, 23, 24], "amrut": 36, "amulet": 11, "amulet_neglog10qv": 11, "amulet_pv": 11, "amulet_qv": 11, "amulet_result": 11, "amulet_scores_": 11, "amz": 2, "an": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 46, 47, 48, 49, 50, 51], "ana": [13, 24], "anaconda": [5, 8, 11, 13, 26], "anaconda3": [13, 25], "analog": [11, 13, 19, 22, 23, 47, 49, 50], "analogi": 25, "analys": [1, 7, 10, 11, 14, 15, 18, 19, 21, 23, 24, 25, 48, 49, 51], "analysi": [0, 5, 6, 7, 8, 11, 17, 18, 21, 23, 24, 25, 27, 29, 30, 31, 32, 33, 34, 37, 38, 39, 41, 48, 50, 51], "analyst": [6, 13, 15, 21, 24, 30, 32, 33, 36, 49], "analyt": [15, 30, 49], "analytic_pearson": 33, "analytic_pearson_residu": 33, "analyz": [0, 1, 2, 3, 5, 8, 9, 11, 13, 15, 18, 19, 22, 23, 24, 30, 33, 37, 39, 40, 41, 48, 49, 50, 51], "anand": 1, "anastasi": 23, "anastasia": [13, 14, 15, 21, 23, 27, 28], "anastasiya": 4, "ancestor": 50, "ancestr": [3, 4, 49], "ancestri": 49, "anchor": [7, 18, 26, 27], "anchorset": [7, 27], "ancom": 13, "ander": [14, 19, 22], "andersen": [5, 14, 19, 27, 28], "anderson": [14, 16], "andersson": [36, 41], "andr": [23, 25, 48, 50], "andra": 49, "andrad": 11, "andrea": [2, 13, 17, 23, 24, 26, 29, 48, 51], "andreani": 11, "andrew": [3, 4, 5, 7, 8, 9, 13, 14, 16, 17, 19, 23, 27, 28, 47, 50], "andrusivova": 7, "andrzej": [19, 22, 23], "anemia": 24, "ang": [1, 7], "angela": [5, 7, 11, 14, 16, 19, 27, 28, 34, 48], "angelidi": 7, "anger": [2, 19], "angl": 5, "anh": [15, 26], "ani": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 30, 34, 36, 45, 48, 49, 51], "anika": 51, "anil": [14, 16], "anim": 9, "anindita": [23, 24, 50], "anja": [5, 15, 40], "anjan": 24, "ank1": 26, "ann": [2, 7, 11, 23, 27, 28, 34, 48, 49], "anna": [4, 5, 6, 7, 8, 11, 16, 17, 19, 23, 24, 26, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "annal": 49, "annalena": 50, "anndata": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 18, 23, 25, 26, 27, 28, 30, 32, 33, 34, 36, 37, 38, 40, 43, 48, 50, 51], "anndata2ri": [7, 11, 14, 15, 17, 21, 25, 27, 28, 31, 32, 33, 34], "anndata2sc": 21, "anno_col": 13, "annoamc": 5, "annocol": 8, "annocxj": 5, "annoehp": 5, "annofg": 5, "annohhan": 5, "annohz21": 5, "annoi": 7, "annoklmst": 5, "annoknw": 5, "annolnl": 5, "annolrc": 5, "annopm22": 5, "annoprojoariassb21": 5, "annopst19": 5, "annoslc": 5, "annosmal": 17, "annosramirezsuastegui": 5, "annot": [1, 2, 3, 4, 6, 7, 8, 10, 11, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 28, 29, 34, 36, 37, 38, 40, 44, 45, 49, 50], "annotat": 4, "annotate_1": 8, "annotate_nhood": 13, "annotate_nhoods_continu": 13, "annotateddatafram": 17, "annotation_adata_out": 5, "annotation_list": 38, "annotationdbi_1": 8, "annotations_fnam": 26, "annotwve19": 5, "annowry16": 5, "annowsf": 5, "annozen22": 5, "annozkt19": 5, "annozoflanaganc": 5, "annual": [4, 49], "anoop": 49, "anoth": [1, 4, 5, 6, 7, 9, 11, 13, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 36, 40, 48, 49], "anoushka": 24, "anpep": 27, "ansari": [3, 5, 7, 50, 51], "anscomb": 41, "anslei": 5, "ansuman": 3, "answer": [2, 3, 4, 7, 8, 13, 14, 15, 16, 21, 24, 25, 26, 42, 50], "answer_color": 42, "anthoni": [32, 33, 34, 49], "anti": [13, 23], "antia": 2, "antibodi": [2, 3, 4, 5, 16, 17, 28, 43, 47, 48], "anticip": 49, "antigen": [2, 3, 4], "antiprolif": 14, "antisens": 23, "antivir": 14, "antoin": [5, 7, 14, 17, 26, 50], "antonet": 16, "antonio": [13, 14, 23], "anupriya": 17, "anur": 49, "anyio": [1, 21], "anymor": [1, 2, 3, 4, 13, 19], "anyth": [19, 28], "anywai": 28, "anywher": 49, "ao": 37, "aohl21": 25, "aoki": 5, "ap11": 2, "ap6": [1, 4], "apach": 30, "apalategui": 29, "aparicio": [5, 14], "aparna": 5, "apart": [7, 21, 40, 45], "apbb1": 8, "apca": 27, "api": [30, 49], "aplic": 15, "apoptosi": 25, "appar": [13, 19, 48], "appdata": 17, "appear": [1, 7, 13, 14, 18, 19, 23, 24, 28, 29, 34, 36, 40, 49], "append": [3, 5, 7, 15, 34, 48, 49], "apperloo": [5, 7, 50], "appl": 15, "appli": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 29, 33, 34, 36, 37, 38, 44, 45, 48, 49, 50, 51], "applic": [3, 4, 7, 11, 13, 15, 16, 19, 23, 24, 25, 30, 33, 38, 39, 49, 50, 51], "apply_1": [25, 27, 28], "appnop": [7, 15, 21], "apport": 23, "appreci": 1, "approach": [2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 27, 30, 32, 33, 36, 37, 39, 40, 41, 43, 45, 47, 49, 50, 51], "appropri": [1, 4, 7, 13, 16, 17, 21, 23, 31, 48, 50], "approv": [6, 14], "approx": 13, "approxim": [3, 8, 13, 16, 23, 26, 31, 32, 33, 49, 50, 51], "apr": [4, 5, 14, 24, 25, 47, 48], "april": [7, 9, 13, 23, 36, 51], "aqueou": 18, "aquino": 26, "ar": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "ara": 26, "arac": 25, "arampatzi": 50, "aran": 17, "arang": [15, 19], "aravind": 15, "arbitrari": [3, 4, 5, 7, 14, 15, 21, 23, 32, 33, 38], "arbitrarili": 21, "arbores": 23, "arc": [11, 18, 51], "archer": 24, "arches_param": 27, "architectur": [3, 16, 38], "archr": 9, "ardgenvldi": 4, "area": [1, 16, 21, 22, 23, 24, 25, 26, 36, 37, 49], "arfa": 14, "arg": [7, 21, 27, 28, 38, 42, 49], "argcomplet": 21, "argelaguet": [7, 28], "argmin": 50, "args_swarmplot": 13, "argsort": 32, "argu": 49, "arguabl": 3, "arguel": [5, 7, 50], "argument": [4, 7, 11, 13, 19, 21, 23, 31, 34, 36, 38, 40], "ari": 28, "ari_": 28, "ari_clust": [7, 28], "aria": 5, "ariann": 13, "ariel": [7, 13, 14, 16, 23], "arik": [17, 26], "arioth": 23, "aris": [7, 14, 16, 23, 28, 49], "arisen": 23, "arithmet": 16, "aritra": 16, "armingol": 25, "arni": 14, "arnol": 28, "arnold": [3, 4], "arnon": 16, "around": [1, 5, 7, 8, 11, 13, 14, 23, 36, 40, 46, 48, 49, 51], "arpack": [19, 31, 45], "arpan": 37, "arrai": [1, 4, 5, 11, 13, 14, 16, 19, 24, 25, 26, 27, 30, 37, 40], "arrang": [1, 25], "array_col": [36, 37], "array_row": [36, 37], "array_split": 14, "arrayexpress": 3, "arraylik": [11, 36], "arriv": 38, "arrow": 21, "arrow_10": 8, "arswnsnygeyyfdi": 4, "art": 31, "artefactu": [11, 23], "artem": 36, "arthur": [15, 43], "arti": 37, "articl": [2, 4, 5, 9, 11, 13, 14, 16, 17, 19, 24, 25, 27, 28, 31, 33, 34, 36, 38, 39, 40], "artifact": [11, 14, 23, 36, 48, 50, 51], "artifici": [7, 11, 16, 18, 23, 34], "artyomov": [15, 17], "arun": 7, "arup": 43, "arutyunyan": 36, "arxiv": [2, 5, 13, 14, 16, 17, 19, 22, 23, 24, 27, 28, 29, 33, 38, 47, 48, 50, 51], "aryan": 36, "arye": 32, "aryeh": 49, "aryfgnlfamdf": 4, "aryygnlyamdi": 4, "as1": [7, 8], "as_tibbl": 25, "asa": 11, "asami": 49, "asap": 48, "asarrai": 37, "ascend": [5, 15, 16, 26, 49, 51], "ascertain": 25, "aschenbrenn": [17, 26], "ascii": 18, "asciitre": 1, "ash": 17, "ashcroft": 1, "ashenberg": [7, 50], "ashlei": 25, "ashuach": [7, 9, 15, 28], "asic5": 15, "asid": 23, "ask": [7, 16, 23], "askpass_1": 8, "asp": 36, "aspect": [3, 15, 19, 24, 48, 49], "asrpsglntdtqi": 4, "assai": [2, 7, 8, 11, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 32, 36, 38, 39, 48, 49, 50], "assaycent": 8, "assaydata": 17, "assdsstdtqi": 4, "assembli": [2, 18, 24, 26], "assert": [15, 27, 38, 50], "assertthat_0": 8, "assess": [5, 7, 8, 11, 13, 14, 15, 17, 23, 25, 26, 28, 33, 34, 36, 38, 41, 49, 51], "assign": [1, 3, 4, 5, 7, 11, 13, 15, 16, 23, 24, 25, 36, 37, 38, 49, 50, 51], "assign_diseas": 4, "assipgavheqi": 3, "assldardrgrvteaf": 3, "associ": [2, 4, 5, 7, 8, 11, 13, 15, 17, 18, 19, 22, 23, 24, 25, 26, 34, 36, 41, 49, 51], "asspgtgtygyt": 3, "asspqtgvarygyt": 3, "assqtggqpqh": 4, "assum": [2, 3, 4, 8, 11, 13, 14, 15, 19, 23, 25, 27, 33, 34, 36, 41, 47, 51], "assumpt": [1, 11, 14, 16, 19, 24, 34, 36, 41, 49, 51], "assyggyneqf": 4, "astrid": [7, 36], "astro": 16, "asttoken": [7, 15, 21, 25], "astyp": [1, 2, 3, 4, 7, 11, 13, 14, 15, 17, 25, 27, 36, 37, 46, 49], "asw": [7, 28], "asw_label": [7, 28], "asymmetr": 49, "asymptomat": 2, "asynchron": 50, "at1": 49, "atac": [7, 10, 11, 19, 22, 27, 28, 50], "atac_atac_frag": [7, 27, 28], "atac_blacklist_fract": [7, 27, 28], "atac_df": 8, "atac_frag": [10, 11, 19], "atac_gene_act": [7, 27, 28], "atac_gene_activity_var_nam": [7, 27, 28], "atac_hvf": 28, "atac_hvf_muon": 27, "atac_lsi_ful": [7, 27, 28], "atac_lsi_r": [7, 27, 28], "atac_multiom": 27, "atac_multiome_queri": 27, "atac_ncount_peak": [7, 27, 28], "atac_nucleosome_sign": [7, 27, 28], "atac_peak": 19, "atac_peak_annot": [11, 19], "atac_pseudotime_ord": [7, 27, 28], "atac_qc_filt": 11, "atac_qc_metr": 11, "atac_reads_in_peaks_frac": [7, 27, 28], "atac_umap": [7, 27, 28], "atacargy22": 9, "atacbgbmp": 9, "atacbgonzalezbmp": 8, "atacbkh19": 9, "ataccla": 11, "atacfpl": 9, "atacgcp": 9, "atacglm": 11, "atacigs22": 9, "atackdh": 8, "ataclbc": 11, "atacmftg22": 9, "atacmk22": 9, "atacnpa": 9, "atacsf12": 8, "atacssls20": 9, "atacswbg17": 8, "atactem": 11, "atak": 26, "atatc": 49, "atbks22": 19, "atchley_factor": 3, "atefeh": 24, "atgaagccagggagct": 7, "athcg": 19, "athhan": 19, "atio": 47, "atjup22": 19, "atkfm": 19, "atla": [5, 7, 13, 24, 28, 37, 50], "atlas": [5, 29], "atlass": 13, "atp": 9, "atp2a2": 36, "atp6v1e2": 15, "atpsk": 19, "atscv22": 19, "atsm22a": 19, "atsm22b": 19, "atss22": 19, "atssf": 19, "attach": [2, 8, 9, 15, 18, 23, 24, 25, 27, 28, 48], "attack": 37, "attcctagtccaagag": 27, "attcgtttcagtattg": 7, "attempt": [7, 8, 13, 14, 16, 17, 23, 25, 27, 51], "attent": [1, 23], "attgg": 49, "attggacagccatcgc": 3, "attila": 51, "attolini": 14, "attr": [1, 7, 21], "attract": [2, 23], "attribut": [1, 2, 3, 5, 7, 15, 16, 25, 27], "atul": 17, "atvrt": 19, "atwat18": 19, "aubrei": 17, "auc": [16, 26], "auc_mtx": 26, "auc_threshold": 26, "aucel": 26, "aucell_1": 8, "aucell_estim": 15, "audienc": 30, "aug": [2, 16, 24, 47, 49], "augur_mod": 16, "augur_results1": 16, "augur_results2": 16, "augur_scor": 16, "august": [2, 5, 7, 23, 24, 26, 36, 50, 51], "augustin": [13, 16], "aupr": 25, "aupr_correct": 25, "aurelien": 15, "auroc": 25, "auror": [5, 7, 50], "aur\u00e9lien": 25, "austin": [4, 5, 7, 27, 50], "author": [0, 3, 22, 30], "auto": [5, 6, 15, 19, 27, 50], "autocorrel": 41, "autocrin": 1, "autodevic": 27, "autoencod": [3, 5, 27, 28], "autoestcont": 34, "autogen": 17, "autom": [19, 23, 24, 29, 30, 51], "automat": [2, 5, 7, 11, 13, 17, 18, 19, 21, 23, 24, 28, 34, 48], "autonotebook": [5, 6, 15, 50], "av20": 49, "avail": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 33, 36, 37, 38, 39, 47, 48, 49, 50], "avasthi": 38, "averag": [3, 4, 11, 13, 14, 16, 18, 19, 23, 24, 25, 32, 33, 34, 36, 38, 40, 51], "avg": 1, "avi": [5, 9, 14, 15, 19, 23, 27, 28, 51], "avid": 3, "avinash": 7, "aviv": [5, 6, 7, 13, 22, 23, 24, 25, 38, 48, 50], "avoid": [1, 2, 3, 4, 5, 7, 8, 11, 14, 17, 19, 21, 23, 32, 34], "avraham": 38, "avsec": 5, "awai": [5, 24, 25, 49], "await": [2, 4, 49], "awar": [13, 15, 23, 24, 25, 39], "awf": 49, "awk": 23, "aws4": 2, "aws4_request": 2, "ax": [1, 4, 5, 7, 8, 11, 13, 14, 15, 16, 19, 23, 25, 26, 32, 33, 36, 38, 44, 48, 49], "ax_col_dendrogram": 4, "ax_row_dendrogram": 4, "axel": [17, 25, 26], "axessubplot": [3, 4, 7, 17, 49], "axhlin": [11, 13, 49], "axi": [3, 4, 5, 7, 8, 11, 14, 15, 16, 23, 25, 26, 27, 28, 36, 44, 49], "axis_kei": 16, "axisarrai": [19, 44], "axisgrid": [13, 48], "axvlin": [11, 26, 49], "ayan": 15, "ayoung": 26, "ayshwarya": [7, 38], "azad": 17, "azim": 25, "azimuth": 5, "b": [1, 2, 3, 4, 5, 6, 7, 12, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 28, 29, 37, 41, 43, 44, 45, 46, 49, 50, 51], "b1": [5, 7, 12, 13], "b10": 13, "b10_ttaggtctagactc_salmonella_goblet": 13, "b10_ttagtcaccatggt_salmonella_ta": 13, "b10_ttatggcttaacgc_salmonella_ta": 13, "b10_ttcatcgaccgtaa_salmonella_ta": 13, "b10_ttgaacctcatttc_salmonella_ta": 13, "b10_tttcacgacaagct_salmonella_ta": 13, "b10_tttcagtgaggcga_salmonella_enterocyt": 13, "b10_tttcagtgcgacat_salmonella_stem": 13, "b10_tttcagtgtgacca_salmonella_endocrin": 13, "b10_tttcagtgttctca_salmonella_enterocyt": 13, "b18cb63ca03820e07cb8b3d9375466ca6405e655822269f5ae36d7449a28b810": 2, "b1_aaacataccacaac_control_enterocyt": 13, "b1_aaacgcacgaggac_control_stem": 13, "b1_aaacgcactagcca_control_stem": 13, "b1_aaacgcactgtccc_control_stem": 13, "b1_aaacttgaccacct_control_enterocyt": 13, "b1_aaaggcctaaggcg_control_stem": 13, "b1_aacacgtgatgctg_control_ta": 13, "b1_aacttgctggtatc_control_enterocyt": 13, "b1_aagaacgatgactg_control_enterocyt": 13, "b1_aattacgaaacaga_control_enterocyt": 13, "b2": 13, "b2m": [4, 14, 25], "b3": 13, "b4": 13, "b5": 13, "b6": 13, "b7": 13, "b8": 13, "b9": 13, "b_cell": 14, "b_cells_1": 17, "b_cells_2": 17, "b_plasma_ct": 5, "b_plasma_mark": 5, "ba": [14, 17, 26], "baaijen": 14, "babel": [1, 21], "bacardit": 50, "bach": [1, 2, 29], "bach2": [5, 12], "back": [1, 4, 5, 7, 13, 14, 19, 23, 24, 25, 26, 27, 28, 36, 38, 42, 45, 47], "back_color": 42, "back_font_s": 42, "backcal": [1, 7, 15, 21, 25], "backend": 5, "backfac": 42, "backflow": 51, "background": [3, 8, 9, 13, 15, 18, 22, 25, 27, 28, 30, 34, 42, 47, 48], "background_expressed_gen": 25, "background_gen": 25, "background_gradi": 7, "backports_1": 25, "backtrac": 23, "backup_url": [5, 15, 25, 31, 32, 33, 34, 36, 38, 43, 48], "bacteri": [13, 24], "bacteriophag": 24, "bad": [13, 23, 29, 38], "badger": [48, 50], "badia": 15, "bae": [26, 49], "bagaev": 4, "bagdatli": 9, "bage5": 19, "baghdassarian": 25, "baglaenko": [7, 44], "bagnoli": 24, "baharak": [5, 7, 50], "bahlo": 6, "bai": [23, 49], "bailei": 49, "bakhti": 51, "bakken": 24, "balanc": [7, 13, 14, 27, 30, 49], "balanced_sampl": 3, "balancing_weight": 27, "balasubramanian": 24, "baldr": 2, "bali": 2, "ballk": 40, "balogh": 50, "balvert": 14, "bam": [18, 23], "bambouskova": 17, "banchereau": 11, "banchero": 5, "band": 23, "bang": 50, "banovich": [5, 7, 50], "bao": 37, "baoguo": 36, "baom": 37, "baptista": 50, "bar": [1, 7, 15, 18, 24, 41, 49], "baraa": 23, "barak": [13, 24], "barbanson": [14, 50], "barbara": [7, 17, 25], "barbri": [5, 7, 24, 50], "barcel": 13, "barcod": [2, 3, 4, 9, 11, 13, 16, 18, 19, 24, 27, 34, 39, 41, 48, 49], "bare": 13, "baril": 51, "barkan": 24, "barker": [50, 51], "baron": [7, 17, 49, 50], "barplot": [1, 13], "barr": [4, 24], "barraud": [14, 16], "barrio": 3, "bart": 50, "barton": [2, 24], "baruzzo": 25, "base": [1, 2, 3, 4, 6, 8, 9, 13, 14, 15, 16, 17, 18, 19, 22, 25, 26, 27, 28, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 43, 46, 47, 48, 49, 50, 51], "base64enc_0": [8, 25], "base_famili": 8, "base_s": [1, 4], "basel": 14, "baselin": [2, 15, 36], "bash": 4, "bashford": 48, "bashrc": [3, 4], "basi": [5, 7, 15, 19, 24, 26, 28, 29, 31, 50, 51], "basic": [2, 4, 14, 16, 17, 18, 21, 22, 23, 24, 25, 26, 30, 33, 34, 37, 38, 49], "basilisk": [8, 21], "basilisk_1": 8, "bassler": 7, "bastiaan": [7, 49], "bastian": [7, 11, 27, 28, 34, 48], "bastida": 51, "basu": [23, 24], "batch": [5, 8, 14, 15, 16, 18, 24, 26, 27, 28, 33, 34, 36, 43, 45, 46, 47, 48], "batch_color": [7, 13, 14, 27, 28, 43, 44, 45], "batch_condit": 36, "batch_correction_metr": 28, "batch_kei": [7, 13, 16, 26, 27, 28, 36], "batch_list": 7, "batch_siz": [16, 36], "batchbench": 7, "batches_to_keep": 28, "batll": 24, "battich": 50, "batut": 23, "bay": [7, 14, 15, 36], "bayann": 50, "bayesian": [3, 13, 49, 51], "bayesspac": 37, "bayraktar": [5, 25, 36], "bbab035": 5, "bbab265": 17, "bbc57": 31, "bbk20": 2, "bbknn": 7, "bbox_to_anchor": [1, 28], "bbr": 49, "bbw057": 14, "bc": 13, "bcdc22": 25, "bcl": 23, "bcl11a": [5, 12], "bcl11b": 12, "bcl2": [5, 12], "bcr": [2, 19], "bcr2_logo_motif": 1, "bcr_00_gex": 3, "bcr_00_read_align": [2, 3], "bcr_01_preprocess": [2, 3, 4], "bcr_cellrang": 2, "bcr_filter": 1, "bcr_logo_motif": 1, "bcv": 14, "bdata": 19, "bdg": 49, "bead": [2, 9, 23, 24], "bear": [19, 38], "beat": [23, 24], "becaus": [0, 1, 2, 3, 5, 7, 8, 13, 14, 16, 18, 19, 21, 23, 24, 25, 27, 45, 48, 49], "becavin": [7, 50], "becht": 22, "becker": [17, 26], "beckstett": [17, 26], "becom": [1, 6, 11, 21, 22, 23, 24, 25, 29, 34, 36, 49, 50], "bed": [11, 19], "been": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 34, 37, 38, 41, 44, 45, 48, 49, 50, 51], "beerenwinkel": 14, "beeswarm_0": 8, "befor": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "beforehand": 23, "begin": [2, 8, 9, 19, 24, 38, 49, 50, 51], "beginn": [22, 30, 33], "behav": [19, 30, 49], "behavior": [4, 19, 23, 34, 49], "behaviour": [1, 15, 38], "behavour": [7, 11], "behind": [1, 2, 7, 19, 30], "behjati": [23, 34, 50], "behren": 9, "beid": 49, "beij": [8, 50], "beilina": 17, "being": [1, 2, 3, 4, 7, 8, 11, 14, 16, 18, 21, 23, 24, 25, 30, 33, 34, 36, 37, 49], "bel": 7, "belaid": 11, "belein": 50, "belgrad": [23, 24], "believ": [13, 23, 49], "belinda": [7, 14, 15], "bell": [23, 49], "bellman": 31, "belong": [1, 3, 5, 7, 13, 14, 15, 16, 18, 19, 23, 25, 36, 37, 38, 40, 49], "below": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 16, 19, 21, 23, 24, 26, 27, 34, 48, 49], "beltram": [7, 23, 51], "ben": 24, "benc": 25, "benchmark": [4, 5, 8, 9, 11, 14, 15, 17, 18, 22, 23, 24, 26, 27, 28, 30, 33, 34, 36, 38, 48, 49], "benedict": 24, "benedikt": [19, 37, 40, 41], "benefici": [13, 14, 15, 23, 30, 33, 43], "benefit": [1, 23, 30, 31, 34, 45], "benhamm": 23, "benhar": 7, "benilton": [19, 22], "benisse_bcr": 3, "benisse_bcr_contig": 3, "benisse_clust": 3, "benisse_encoded_bcr": 3, "benisse_gex": 3, "benjamin": [1, 3, 14, 15, 17, 23, 24, 26, 39, 41], "benjamini": [13, 14], "benson": 2, "bent": [23, 24], "benthem": 14, "beppu": [23, 24], "beren": 31, "berg": [5, 7, 14, 50], "bergen": [50, 51], "bergenstr": 7, "bergenstr\u00e5hl": 36, "berger": 7, "berkelei": 50, "berlin": [7, 21, 42], "bernadett": 16, "bernard": [7, 11, 24, 27, 28, 34, 48], "bernett": 17, "bernhard": [26, 51], "bernoulli": [18, 28], "bernstein": 23, "bert": 49, "berta": 25, "bertagnolli": 24, "berthold": [6, 50, 51], "bertil": 23, "bertram": 15, "bertrand": [5, 14, 16, 19, 27, 28, 48, 50], "berub": 49, "besid": [1, 11], "best": [3, 5, 7, 8, 9, 11, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 34, 36, 41, 44, 49, 50, 51], "best1": 8, "best_model_by_metr": 3, "best_practic": 10, "best_practices_annot": 5, "best_practices_regulons_rnanatac": 8, "best_trial": 3, "bestpractic": 4, "bestpracticestart": 1, "beta": [1, 4, 14, 15, 25, 37, 51], "beta_": 36, "beta_g": 51, "beta_ufunc": [1, 7, 15, 21, 25], "beth": 49, "better": [1, 2, 3, 4, 5, 6, 7, 11, 12, 13, 14, 15, 16, 17, 18, 23, 24, 25, 28, 33, 34, 36, 38, 41, 48], "bettina": 24, "between": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 39, 41, 44, 47, 48, 49, 50, 51], "beumer": 50, "beyaz": [13, 22], "beyer": 48, "beyond": [1, 13, 19, 23, 29, 30, 49, 50, 51], "bfgp": 25, "bg_color": 42, "bgcv01_aaacctgagaccggat": 4, "bgcv01_aaacctgaggaactgc": 4, "bgcv01_aaacctgagggatctg": 4, "bgcv01_aaacctgcaacgcacc": 4, "bgcv01_aaacctgcacgtgaga": 4, "bgll08": 6, "bh": 13, "bharadwaj": [23, 24], "bhattacherje": 16, "bhattacherjee_15": 16, "bhattacherjee_48": 16, "bhattacherjee_adata": 16, "bhattacherjee_adata_15": 16, "bhattacherjee_adata_15_permut": 16, "bhattacherjee_adata_48": 16, "bhattacherjee_adata_48_permut": 16, "bhattacherjee_results_15": 16, "bhattacherjee_results_15_permut": 16, "bhattacherjee_results_48": 16, "bhattacherjee_results_48_permut": 16, "bhupesh": 50, "bhutani": 24, "bi": 23, "bia": [4, 7, 13, 14, 18, 23, 24, 25, 34, 41], "biala": [23, 24], "biancalani": 38, "bias": [4, 5, 7, 13, 17, 23, 24, 26, 32, 47, 49], "bib": [5, 14, 17], "bic": 41, "bichao": 37, "biddi": 49, "bidirect": 15, "bieberich": 2, "biela": [23, 24, 37], "bifurc": [49, 50], "big": [7, 15, 24, 29, 36, 45], "bigger": [5, 7], "biggest": [0, 1, 19], "bihan": 23, "bijan": 49, "bijb19": 2, "biject": 23, "bilali": 1, "billion": [18, 23], "bimod": [1, 13, 23], "bin": [7, 8, 9, 11, 13, 21, 23, 24, 26, 33, 34, 36, 38, 49], "bin_path": 8, "binar": [9, 28], "binari": [13, 18, 19, 21, 27, 28, 48], "bind": [2, 3, 4, 8, 9, 18, 24, 25, 26, 47, 48], "bind_row": 25, "bindel": 36, "binder": 4, "binding_fullir": 4, "binding_ham": 4, "bing": [9, 15, 50], "bingyi": 25, "binom_ufunc": [1, 7, 15, 21, 25], "binomi": [14, 15, 18, 28, 32, 33, 36, 41, 47, 48], "binomial_devi": 32, "binrang": 11, "binstadt": 2, "bio": [1, 7, 27, 28], "bio_conservation_metr": 28, "bioarxiv": 51, "biobank": 24, "biobas": [7, 17, 21], "biobase_2": [8, 15, 27, 28], "bioc_h5mu_fil": 21, "biocgener": [7, 21], "biocgenerics_0": [8, 15, 25, 27, 28], "biochem": 25, "biocio_1": 8, "biocmanag": 8, "bioconda": [5, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 25, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 51], "bioconductor": [7, 8, 11, 13, 14, 15, 19, 25, 27, 28, 31, 32, 33, 34], "biocparallel": [33, 34], "biocparallel_1": 8, "bioinformat": [1, 2, 4, 5, 7, 13, 14, 15, 16, 17, 19, 23, 24, 25, 30, 41, 47, 50], "bioinformatician": [5, 30], "biol": [26, 37], "biolog": [1, 5, 7, 9, 14, 15, 16, 17, 18, 19, 23, 25, 26, 29, 30, 32, 33, 34, 36, 38, 39, 45, 48, 49, 50, 51], "biologi": [0, 1, 2, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 28, 29, 30, 32, 33, 34, 36, 39, 41, 48, 49, 50, 51], "biologist": [5, 30], "biomedcentr": 11, "biometr": 33, "biomolecul": 18, "bionti": [49, 50, 51], "biophys": 47, "biorend": [2, 9], "biorxiv": [3, 5, 7, 9, 13, 14, 15, 16, 19, 23, 25, 27, 28, 29, 37, 41, 47, 48, 49, 50], "bioscienc": [7, 24], "biostatist": [7, 14], "biostrings_2": 8, "biotechnol": 37, "biotechnologi": [3, 5, 6, 7, 13, 14, 15, 16, 17, 23, 24, 25, 27, 36, 39, 48, 49, 50, 51], "biotinyl": 48, "bipot": 5, "birgit": [17, 26], "bit": [5, 8, 15, 21, 25, 27, 28], "bit64": 21, "bit64_4": 8, "bit_4": 8, "biton": [13, 22], "bitop": [7, 21], "bitops_1": [8, 15, 25, 27, 28], "bivona": 49, "bizzotto": 49, "bj": [15, 24], "bjoern": 4, "bjorkman": 4, "bkk": 49, "bkp_path_ciscorr": 8, "bl": 15, "bla": [8, 9, 15, 25, 26, 27, 28], "blaauw": 51, "black": [5, 11, 49], "blackburn": [2, 24], "blacklist": 11, "blacklist_fract": 11, "blacklist_repeats_segdups_rmsk_hg38": 11, "blake": 4, "blattman": 2, "blaxal": 23, "blish": [5, 14, 19, 25, 27, 28], "blk": [5, 12], "blob": 7, "blob_1": 8, "block": [4, 13, 42], "blockad": 3, "blogpost": 13, "blondel": 6, "blood": [2, 5, 14, 16, 19, 24, 49, 50, 51], "bloom": [7, 11, 27, 28, 34, 48], "blosum": 4, "blue": [7, 11, 13, 14, 15, 23, 26], "blueprint": 17, "blyth": 1, "bmc": [1, 13, 14, 15, 17, 23, 26, 50], "bmp_0": 8, "bo": [16, 37, 48, 49, 50], "boaz": 24, "bob": 23, "bodi": [2, 9, 24, 30], "boettcher": 51, "bogdan": 17, "bohao": 25, "bohrson": 49, "boi": 25, "boil": 13, "boland": 4, "bold": 42, "boldsymbol": 36, "bolker": 14, "bollback": 49, "bolster": 49, "bolt": [5, 7, 50], "bomb": 37, "bonaguro": [17, 26], "bond": [18, 48], "bone": [2, 5, 7, 28, 34, 48], "bonhoeff": 1, "boni": [7, 11, 27, 28, 34, 48], "bonk": 24, "bonn": 17, "bonnar": 16, "bonni": 7, "booeshaghi": [23, 51], "book": [0, 2, 3, 5, 19, 21, 31, 34, 37, 40, 50], "bool": [1, 13, 15, 32], "boolean": 19, "boor": 36, "bootstrap": 13, "borcherd": 2, "border": [5, 42], "borderaxespad": 28, "bore": 30, "bori": 15, "borm": [50, 51], "bormann": 2, "bort": 49, "bose": 23, "bosiljka": 24, "bosing": 2, "bosquillon": [17, 26], "boss": 5, "bot": [1, 2, 25, 50], "both": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 36, 37, 38, 39, 41, 42, 44, 46, 48, 49, 50, 51], "bottino": 40, "bottleneck": 16, "bottom": [11, 23, 25, 42], "boucher": 5, "boudewijn": 14, "bouka": 51, "bouman": 51, "bound": [2, 24, 48], "boundari": [11, 37, 51], "bourgain": [39, 41], "boutet": 24, "bowen": [17, 26], "box": [23, 42], "boxplot": [5, 13, 17, 48], "boyang": 14, "boyeau": [7, 36], "bp": [7, 24, 50], "bp2": 19, "bp_pp": 6, "bpparam": 33, "br": [23, 42], "bracer": 2, "bracken": 16, "brad": 49, "bradlei": 3, "braeun": 24, "brai": 23, "brain": [15, 23, 24, 37, 49], "brainbow": 49, "brake": 51, "brampton": 24, "branch": [5, 49, 50], "branco": [50, 51], "brandon": [15, 23], "braun": [7, 50, 51], "braunger": 15, "bravo": [8, 9, 15, 19, 22, 26], "breadth": 5, "break": [1, 2, 8, 23, 49], "breakdown": 5, "breakpoint": 1, "breaks_pretti": 8, "bredikhin": [19, 28, 48], "brenner": [7, 44], "brent": 49, "brewer_heat": 8, "brewer_purpl": 8, "brian": [2, 7, 15, 16, 17, 23, 24, 47, 48, 49, 50], "brickman": 25, "bridg": [2, 48], "bridget": 17, "bridi": [3, 4], "brief": [5, 14, 17, 25, 49], "briefli": [8, 15, 21, 24, 49], "brien": 51, "brigg": [1, 50], "brighter": 14, "brigitt": 51, "brill": 13, "brinei": 2, "bring": [19, 29, 48], "brink": 7, "briseisencod": 3, "british": 24, "britt": 49, "britta": 28, "brittani": 5, "brittl": 24, "broaden": 25, "broader": [22, 24], "broadli": [8, 13, 19, 39, 51], "broekhui": 49, "broken": [2, 24, 34, 49], "brook": 14, "brotli": [1, 21], "brought": [24, 31], "browaei": 25, "browaeys_2020": 25, "brown": [3, 24, 38], "browser": 23, "bruce": 30, "bruggen": [50, 51], "brumhard": [17, 26], "brunner": 29, "bruno": 7, "bryan": [2, 7], "bryce": 2, "bryson": 7, "br\u00fcning": 23, "bsgenom": [8, 11], "bsgenome_1": 8, "bss20": 25, "btaa611": 19, "btaa739": 4, "btaa777": 23, "btab036": 25, "btab164": 41, "btac775": 25, "btla": 27, "btp616": 14, "btw631": 2, "bty175": 47, "bty191": 23, "bty888": 23, "btz444": 17, "btz625": 7, "btz698": 23, "bubbl": 23, "buchanan": 7, "buchwalt": 9, "budd": 49, "budget": 24, "budin": 15, "buencolor": 8, "buencolors_0": 8, "buenrostro": [8, 11, 38, 50], "buenrostrolab": 8, "buettner": 50, "buffer": [2, 24], "buffoni": 38, "bug": [1, 4, 19], "bugarin": 48, "buhlmann": 15, "bui": [5, 7, 14, 50], "build": [3, 8, 13, 18, 19, 22, 38, 44, 49], "build_nhood_graph": 13, "built": [0, 7, 10, 23, 27, 49], "bulk": [7, 9, 14, 18, 24, 25, 39], "bulk_sc_gen": 17, "bulkahb17": 17, "bulkat21": 17, "bulkbvw": 17, "bulkdata": 17, "bulkdcw19": 17, "bulkkkb": 17, "bulkmlx": 17, "bulkmmo": 17, "bulkno": 17, "bulknsl": 17, "bulksch10": 17, "bulksmal": 17, "bulksog13": 17, "bulkssrp": 17, "bulkzbsa19": 17, "bull": 49, "bulletin": 33, "bunch": 27, "bundl": 24, "burden": 13, "burdin": 17, "burgin": [13, 22], "burk": 24, "burkett": 8, "burkhardt": [7, 11, 13, 27, 28, 34, 48], "burmedi": 25, "burn": [13, 23], "burnin": 8, "burton": 2, "burtscher": 51, "busbi": 26, "bushra": 49, "busskamp": 5, "bustool": 23, "butler": [5, 7, 14, 16, 19, 27, 28], "butt": 17, "bx": 17, "byrn": [14, 15, 16, 25, 50], "bystand": 1, "bystrykh": 49, "byunghe": 26, "byungjin": 50, "b\u00fcttner": 5, "c": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 33, 36, 37, 45, 47, 48, 49, 50, 51], "c0": 37, "c1": 37, "c15orf39": 8, "c2": [15, 37], "c2l": 36, "c4orf50": 12, "c5": 15, "c5ar1": 27, "c7": 15, "c_": [36, 38], "c_call": [1, 2], "c_call_b_vdj": 1, "c_call_b_vj": 1, "c_call_vdj": 1, "c_call_vj": 1, "c_gene": 2, "c_i": 38, "ca": [26, 49], "ca06": 2, "caagtdyeqyf": 4, "caaqgssmetqyf": 4, "caartvntgelff": 4, "caavqgpsyeqyf": 4, "caawddslsasyvf": 2, "cabello": 25, "cabl": 36, "cabrera": 49, "cacagtaagtgtccat": 3, "cacer": [7, 11, 27, 28, 34, 48], "cacgagedtgelff": 4, "cacgkgggslrytf": 4, "cacgpggpstdtqyf": 4, "cachem_1": 8, "cacpstsgintgelff": 4, "cacrglagyeqyf": 4, "cadarsswdtqyf": 4, "cadm1": [5, 12], "caeagrddkiif": 4, "caenorhabd": 49, "caggsqwevkldyw": 3, "cagtaaccaggaatcg": 3, "cahil": 49, "cai": [7, 37, 49], "cairo": [8, 11], "cairo_1": 8, "caisasgggssgntiyf": 4, "caitlin": [25, 50], "caiyun": 5, "cakawigldseiyydyiwgsyridfdyw": 2, "calcium": 25, "calcnormfactor": [14, 15], "calcsoupprofil": 34, "calcul": [1, 3, 4, 5, 6, 8, 10, 13, 14, 17, 19, 21, 25, 26, 27, 28, 31, 33, 34, 37, 38, 40, 41, 50, 51], "calculate_adj_matrix": 37, "calculate_qc_metr": [11, 19, 21, 34, 48], "calculate_threshold": 1, "calculatecpm": 21, "caleb": [8, 9, 11, 48, 49, 50], "caleblareau": 8, "calero": [1, 2], "calibr": 18, "california": 50, "call": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 15, 17, 18, 19, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 37, 40, 47, 48, 49, 50, 51], "callan": 1, "callback": [14, 27, 28, 32, 33, 34], "callori": 7, "callr_3": 8, "cam": 50, "camargo": 49, "cambridg": [1, 2], "came": [14, 49], "camera": [2, 15], "cameron": 25, "camil": 14, "camillo": 25, "camk2n1": 41, "camp": 23, "campbel": [5, 14, 34], "campo": 5, "can": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "cancan": 7, "cancer": [13, 15, 16, 30], "candid": [1, 8, 26, 40], "caneda": 24, "cang": [25, 39, 41], "cannoodt": [7, 11, 27, 28, 34, 48, 50], "cannot": [2, 4, 5, 7, 8, 10, 14, 16, 19, 21, 26, 30, 49, 51], "canon": 25, "canptrpyssswwyfdyw": 2, "canzar": 2, "cao": [7, 13, 16, 23, 27], "cap": 23, "capabl": [3, 16, 19, 23, 24, 25, 26, 49], "capac": [2, 13, 24, 49], "capit": [26, 42], "cappuccio": 14, "captum": 5, "captur": [2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 28, 30, 31, 33, 34, 36, 37, 38, 39, 43, 47, 48, 49, 50, 51], "caputo": 7, "carci": 13, "card": 42, "cardin": 23, "cardiomyocyt": 36, "cardnrvyydfwsgypdyw": 2, "cardrrsaycsggscwggdwfdpw": 2, "care": [3, 4, 5, 7, 11, 14, 36, 51], "carefulli": [4, 15, 23, 33, 49], "caregmvyvdyw": 3, "carei": [17, 19, 22, 50], "caret_6": 25, "carl": [14, 23], "carli": 7, "carlo": [5, 7, 11, 16, 23, 27, 49, 50], "carlson": [19, 22, 49], "carmen": [8, 9, 15, 25, 26], "carntgnqfyf": 4, "carolin": [24, 50], "carolina": 51, "carpp": 22, "carprsliaaagafdiw": 3, "carr": 23, "carri": [2, 4, 15, 18, 23, 24, 25, 49], "carrier": 24, "carrol": 24, "carr\u00e9": 17, "carsten": 24, "carswel": [2, 24], "cartridg": 17, "carvalho": [19, 22], "cas13": 16, "cas9": [16, 49], "cascad": 51, "case": [1, 2, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 19, 21, 22, 23, 24, 26, 27, 30, 31, 32, 34, 36, 37, 38, 47, 49, 50, 51], "caseevtmvrgvmfpygmdvw": 3, "casei": 23, "casp8": 8, "casp9": 3, "casper": [14, 24], "casrpsglntdtqyf": 4, "cassargasgertdtqyf": 1, "cassdsstdtqyf": 4, "cassett": 49, "cassiopeiasolv": 49, "cassiopeiatre": 49, "cassipoeia": 49, "casslsgnsyeqyf": 4, "cassqtggqpqhf": 4, "cassqtsggtdtqyf": 4, "cassyggyneqff": 4, "cast": [1, 2], "castelo": [15, 50, 51], "castro": 26, "cat": [5, 13, 14, 25], "catalina": [7, 14], "catalog": [26, 30], "catalogu": 4, "catalyt": 18, "catccaccaacgcacc": 3, "catch": 16, "catct": 49, "categor": [1, 3, 4, 5, 7, 14, 16, 19, 23, 27, 34, 36, 37, 38, 49], "categori": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 19, 23, 25, 36, 37, 39], "categorical_covariate_kei": [7, 27, 28, 36], "categories_dset": 7, "catgagttcagcagag": 28, "catgt": 49, "catherin": [5, 7, 14, 19, 25, 27, 28, 29, 48], "catia": 24, "catools_1": [8, 25], "catqnpgyssswddrgafdiw": 3, "caus": [1, 3, 5, 7, 13, 16, 18, 21, 23, 24, 25, 27, 28, 41, 51], "caution": [3, 4, 5, 6, 16, 25, 48, 51], "cautiou": 3, "caval": 49, "cave": 14, "caveat": [1, 21, 23, 24, 49], "cavgapgddkiif": 4, "cavin": [5, 7], "cavkrgnnarlmf": 4, "cavnspggyqkvtf": 4, "cavselgseklvf": 4, "cavspfnagggnkltf": 4, "cavsvvrnnnarlmf": 1, "cax": [7, 36], "cb": 23, "cb_permit_list": 23, "cbg": 49, "cbl": 15, "cc_aa_ident": 1, "ccattgtgtagacaaa": 7, "cccgg": 49, "ccd": 2, "ccgaa": 49, "ccgttactcaatgtgc": 7, "ccitgb1": 12, "ccl5": [5, 8, 12, 25], "ccm": [4, 49], "ccr4": 27, "ccr6": 27, "ccr7": [5, 8, 12], "cd": [3, 4, 23], "cd101": [12, 45], "cd103": [12, 27, 45], "cd105": [12, 45], "cd112": [12, 45], "cd11b": [12, 27, 43], "cd11c": [12, 27, 43, 45], "cd122": 27, "cd123": 45, "cd124": 27, "cd127": [12, 27], "cd13": [12, 27], "cd137": 27, "cd14": [5, 7, 12, 14, 16, 25, 43, 44, 45, 46], "cd146": 45, "cd14_monocyt": 14, "cd14_monocytes_1": 17, "cd14_monocytes_2": 17, "cd14_monocytes_3": 17, "cd152": [27, 45], "cd154": [27, 45], "cd155": [12, 45], "cd158b": 12, "cd158e1": 12, "cd16": [5, 7, 12, 15, 26, 27, 43, 44, 45], "cd160": 12, "cd161": [12, 27, 45], "cd162": 45, "cd16_monocyt": 17, "cd172a": 12, "cd185": [27, 45], "cd19": [43, 45, 46], "cd194": [12, 27, 45], "cd195": 45, "cd196": [27, 45], "cd1c": 12, "cd20": [5, 7, 12, 27, 45], "cd21": 27, "cd223": 45, "cd224": 45, "cd226": 12, "cd23": [27, 45], "cd24": [5, 12], "cd247": [5, 12, 25], "cd25": [12, 27, 45], "cd26": [12, 27], "cd268": [12, 27], "cd27": 45, "cd270": 45, "cd272": 27, "cd274": 45, "cd278": 27, "cd279": [12, 45], "cd29": 27, "cd3": [27, 43, 44, 45, 46], "cd300lf": 8, "cd303": [12, 27], "cd304": [12, 27], "cd31": 45, "cd314": [12, 27], "cd319": [12, 27], "cd32": [43, 45], "cd328": 45, "cd33": 45, "cd335": [12, 27, 45], "cd34": [5, 12, 17, 38], "cd35": [12, 27], "cd352": [12, 27], "cd366": 16, "cd38": [5, 12, 14, 43], "cd39": [12, 27], "cd3d": 25, "cd3e": 8, "cd3g": [25, 27], "cd4": [1, 2, 4, 5, 7, 12, 14, 25, 26, 43, 44, 45], "cd40": [12, 45], "cd40lg": 27, "cd44": [25, 45], "cd45": 43, "cd45ra": [12, 45], "cd45ro": [12, 45], "cd47": [25, 45], "cd48": [25, 45], "cd49a": 27, "cd49f": [12, 27, 45], "cd4_t_cell": 14, "cd4_t_cells_1": 17, "cd4_t_cells_2": 17, "cd4_t_cells_3": 17, "cd4t_adata": 16, "cd4t_stim": 16, "cd5": 45, "cd52": 45, "cd54": 27, "cd56": [12, 27, 43, 45], "cd57": 12, "cd62l": [27, 45], "cd62p": 12, "cd63": [12, 25], "cd69": [5, 12, 45], "cd7": 45, "cd71": [12, 27], "cd73": 27, "cd74": 12, "cd79b": [5, 12, 27], "cd8": [1, 2, 3, 4, 5, 7, 12, 15, 16, 25, 27, 43, 44, 45], "cd81": 12, "cd82": [12, 45], "cd85j": [12, 27, 45], "cd86": [8, 12, 16, 45], "cd88": [12, 27, 45], "cd8_t_cell": [14, 17], "cd8a": [5, 12, 25, 27], "cd8b": [5, 12], "cd9": 12, "cd94": [12, 27, 45], "cd95": 27, "cdc1": [5, 12], "cdc2": [5, 7, 12], "cdk6": [5, 12], "cdmk13": 1, "cdna": [2, 18, 23, 24], "cdnvh": 1, "cdr": [2, 4], "cdr1": 2, "cdr2": [2, 14], "cdr3": [1, 2, 3, 4], "cdr3_a_aa": 4, "cdr3_b_aa": 4, "cdr3_col": 1, "cdr3_nt": 2, "cdr3b_trim": 4, "cdr3beta": 4, "cdr3\u03b1": [3, 4], "cdr3\u03b2": [3, 4], "cdrh3": 4, "cdrl3": 4, "ce": [7, 11, 27, 28, 34, 48], "ceccarelli": 17, "cecilia": 25, "cedric": [23, 37], "ceglia": 5, "cel": [5, 17, 23, 24, 34], "celina": 15, "cell": [0, 1, 3, 4, 5, 8, 10, 12, 18, 21, 26, 27, 28, 31, 32, 33, 37, 40, 41, 43, 44, 47, 48, 49, 50, 51], "cell2cel": 25, "cell2loc": [37, 38, 40, 41], "cell_": [19, 21], "cell_0": [19, 21], "cell_1": [19, 21], "cell_10": 19, "cell_2": [19, 21], "cell_3": [19, 21], "cell_4": [19, 21], "cell_5": [19, 21], "cell_6": 19, "cell_7": 19, "cell_8": 19, "cell_9": 19, "cell_95": 19, "cell_96": 19, "cell_97": 19, "cell_98": [19, 21], "cell_99": [19, 21], "cell_count_cutoff": 36, "cell_cycle_conserv": [7, 28], "cell_df": 4, "cell_id": [1, 2, 4], "cell_ident": 14, "cell_identity_kei": 14, "cell_label": 13, "cell_label_color": 13, "cell_level": 13, "cell_meta": 49, "cell_percentage_cutoff2": 36, "cell_rang": [7, 17], "cell_state_df": 36, "cell_subsets_r": 17, "cell_typ": [5, 7, 8, 14, 15, 16, 19, 25, 26, 27, 28, 36, 38], "cell_type_col": 16, "cell_type_color": [7, 14, 15, 25, 27, 28, 36], "cell_type_identifi": 13, "cell_type_l1": [27, 28], "cell_type_l2": [27, 28], "cell_type_l3": [27, 28], "cell_type_origin": 36, "cell_type_original_color": 36, "cell_types_to_check": 5, "cellannot": 8, "cellar": 13, "cellassign": 5, "cellbc": 49, "cellbox": 16, "cellcal": 25, "cellcel": 25, "cellchat": 25, "cellchat_pv": 25, "cellfract": 17, "cellgeni": 21, "cellid": [2, 26, 38], "cellink": 25, "cellknn": 8, "cellmark": 15, "cellnam": 17, "cellphone_pv": 25, "cellphonedb": 25, "cellphonedbv2": 25, "cellrang": [3, 4, 11, 23, 34], "cellranger_out": 11, "cellrank": 51, "celltyp": [14, 21], "celltype_color": 21, "celltype_condit": 15, "celltype_to_predict": 16, "celltypeid_new": 38, "celltypenumcutoff": 17, "celltypist": 5, "celltypist_cell_label_coars": 5, "celltypist_cell_label_fin": 5, "celltypist_conf_score_coars": 5, "celltypist_conf_score_fin": 5, "cellular": [5, 6, 11, 13, 15, 16, 17, 18, 19, 23, 24, 25, 26, 30, 33, 34, 38, 40, 48, 49, 50, 51], "celrep": [17, 23], "center": [1, 2, 3, 5, 8, 11, 14, 16, 17, 37, 42], "cento": [27, 28], "centr": [1, 2], "central": [3, 7, 18, 23], "centroid": [3, 44], "centuri": 49, "cerciat": 51, "cerebellar": 24, "cerebellum": 17, "certain": [2, 3, 5, 8, 11, 18, 19, 23, 25, 26, 34, 37, 48, 49], "certainli": 22, "certainti": 5, "certifi": [1, 21], "cesaro": 25, "cesgratitmivvtdldyw": 2, "cetin": 24, "cf": 37, "cffi": [1, 7, 15, 21, 25], "cg": 36, "cg22": 27, "cgata": 49, "cgccg": 49, "cggag": 49, "cggaggatat": 49, "cgttaacaggtgtcca": 7, "cgtwdsslsawvf": 2, "cha": 25, "chad": 24, "chaffin": 7, "chaichoompu": [7, 28], "chain": [1, 2, 3, 4, 15, 17, 18, 24, 49, 50], "chain_pair": [1, 2, 4], "chain_qc": 2, "chain_statu": 1, "chaisson": 23, "chakraborti": 43, "challeng": [5, 7, 9, 11, 13, 14, 16, 17, 21, 23, 24, 25, 28, 29, 30, 33, 34, 39, 47, 48, 49, 50, 51], "chamber": 24, "chan": [5, 26, 49], "chang": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 28, 29, 33, 34, 36, 37, 38, 39, 41, 46, 47, 49, 50, 51], "changeo": 1, "changeo_clone_id": 1, "changeo_clone_id_s": 1, "changeo_clone_id_size_max_50": 1, "channel": [5, 6, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "chantip": [17, 26], "chao": [23, 26], "chaohan": 31, "chapman": 40, "chapter": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 19, 21, 22, 23, 24, 25, 26, 28, 29, 30, 33, 34, 41, 43, 44, 45, 47, 48, 49], "charact": [10, 18, 21, 49], "character": [1, 4, 9, 13, 14, 15, 16, 19, 23, 24, 25, 39, 49, 50], "character_matrix": 49, "character_matrix_filt": 49, "characterist": [2, 3, 11, 13, 23, 24, 25, 37, 50, 51], "chardet": 1, "chardon": 49, "charg": [2, 26], "chariti": [14, 15], "charl": [5, 38, 49], "charlott": [4, 5, 14, 17, 19, 22, 23, 24, 25, 26, 27, 28, 51], "charset_norm": [1, 21], "chart": 7, "chase": [3, 4, 5, 7, 49, 50], "chattopadhyai": [9, 16, 47, 48, 50], "chatzidimitri": 23, "chaudhuri": 17, "chauv": 23, "chauvet": 49, "chavez": 5, "chazarra": 7, "cheaper": [18, 24], "cheapest": 24, "check": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "check_graph": 27, "check_random_st": 15, "checkansw": 42, "checkmate_2": 25, "checkpoint": [16, 27, 48], "checksum": 19, "chee": 37, "cheimona": 1, "chemic": [3, 16, 18, 24, 49], "chemistri": [23, 24, 49], "chen": [3, 5, 7, 11, 15, 16, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 48, 49, 50, 51], "chenchen": 26, "chenfei": 25, "cheng": [7, 13, 17, 26, 36, 37, 38, 49], "chengzh": 5, "chenl": [7, 49], "chenqu": 50, "cheol": 1, "chernyshev": 1, "chevrier": 7, "chevron": 23, "chew": 8, "chex": 7, "chichelnitskii": [5, 7, 50], "chih": 17, "child": 13, "chimenti": 14, "chiou": 7, "chip": [2, 8, 23, 24], "chisq": 14, "chisto": 5, "chlo": [7, 24, 49, 50], "chloe": [7, 11, 14, 27, 28, 34, 48], "chlo\u00e9": 17, "cho": [2, 26, 49], "choi": [25, 49], "choic": [7, 9, 13, 15, 16, 19, 23, 24, 25, 31, 32, 42, 49, 50], "choli": 49, "chong": 5, "choos": [1, 3, 4, 5, 11, 23, 25, 29, 32, 33, 37, 49], "chose": [11, 14], "chosen": [1, 2, 4, 5, 13, 15, 16, 23, 32, 34, 48, 50, 51], "choudhari": 27, "choudhri": 9, "chow": 49, "chozen_isoform": 38, "chr": [8, 25], "chr1": [10, 11], "chr10": 11, "chr11": 11, "chr12": 11, "chr13": 11, "chr14": 11, "chr15": 11, "chr16": 11, "chr17": 11, "chr18": 11, "chr19": 11, "chr2": 11, "chr20": 11, "chr21": 11, "chr22": 11, "chr3": 11, "chr4": 11, "chr5": 11, "chr6": 11, "chr7": 11, "chr8": 11, "chr9": 11, "chri": [16, 23, 24, 30, 49], "christiaen": [8, 9], "christian": [5, 13, 15, 17, 24, 25, 26, 40], "christiansen": [16, 23], "christin": [5, 7, 17, 24, 26, 50], "christina": [3, 4, 19, 23, 37, 40, 41], "christlei": 4, "christof": [17, 24, 26], "christoph": [3, 5, 7, 9, 10, 11, 13, 15, 16, 17, 22, 23, 24, 26, 27, 28, 34, 36, 47, 48, 49, 50], "chrm": 11, "chrom_assai": 10, "chromatin": [7, 9, 11, 18, 19, 26, 28, 30, 39, 48, 50], "chromatinassai": 10, "chromatograph": 2, "chromatographi": [2, 24], "chromium": [9, 23, 24, 49], "chromiumv3": 23, "chromosom": [8, 10, 11, 23, 24], "chromvar": [8, 11], "chromvar_1": 8, "chronist": 4, "chrx": 11, "chry": 11, "chrysa": 2, "chuan": [5, 7, 50], "chuanchuan": 4, "chuang": [15, 36, 38], "chuanyu": 37, "chun": [15, 23], "chuner": 49, "chung": [5, 7, 50], "chunk": [21, 23], "chunlin": 3, "chunquan": 26, "chunyu": 15, "church": 49, "ch\u00e9dotal": 25, "ci": [8, 9, 26], "ciara": 5, "cibersortx": 17, "ciccon": 7, "cicek": 11, "cigar": [23, 49], "circl": [1, 13], "circle_diamet": 36, "circlize_0": [8, 25], "circular": 36, "circumv": [14, 51], "ciro": [5, 7, 43, 44, 45, 46, 47, 48, 50, 51], "cisassign": 8, "ciscorr": 8, "cistarget": 26, "cistop": 9, "cistopic_0": 8, "cistopic_bkp_path": 8, "cistopicobject": 8, "cite": [4, 16, 19, 25, 27, 30, 47, 48, 50], "cite_batch_correct": 44, "cite_dimensionality_reduct": 45, "cite_doublet_removal_xdbt": [44, 45, 46], "cite_filt": [46, 48], "cite_norm": [46, 47], "cite_preprocess": 43, "cite_quality_control": [47, 48], "cite_query_batch": 27, "cite_raw": [47, 48], "cite_reference_batch": 27, "cite_xdbt": [44, 45], "cittaro": 13, "ciup": 1, "ciyu": 16, "ckch21": 1, "cl_annot": 5, "clade": 49, "clade_color": 49, "cladogram": 49, "clair": [4, 49, 50], "clang": [7, 15, 21], "clarif": 30, "clariti": 18, "clark": [5, 7, 15, 50], "clash": 43, "class": [1, 4, 5, 7, 10, 11, 13, 14, 16, 19, 21, 23, 27, 28, 34, 42, 49], "class_7": 25, "classic": [5, 14, 36, 49, 50, 51], "classif": [5, 13, 15, 34, 50], "classifi": [4, 13, 16, 18, 23, 25, 43, 46, 49], "clatworthi": 5, "claudia": [14, 16, 17, 26], "clean": [14, 28], "cleanli": 49, "clear": [1, 3, 5, 7, 13, 14, 22, 23, 34, 36, 37, 44, 49, 51], "clearer": 4, "cleari": [16, 49], "clearli": [3, 6, 7, 13, 14, 15, 16], "cleavag": [1, 9], "clec10a": [5, 12], "clec12a": 5, "clec4c": 27, "clec9a": [5, 12], "clecl1": 15, "clemen": [3, 4], "clemenc": 49, "clement": 11, "clementin": 5, "clever": 50, "cli": [7, 21, 50], "cli_3": [8, 25, 27, 28], "click": [7, 15, 21, 25], "clinic": [17, 48], "clip": 23, "clip_at": 1, "clisi": [7, 28], "clivio": 7, "clonal": [2, 3, 4, 24, 49], "clonal_expans": 1, "clone": [1, 3, 4, 24, 49], "clone_annot": 3, "clone_df": 4, "clone_fil": 3, "clone_id": 3, "clone_kei": 1, "clone_network": 1, "clone_s": 1, "clones_fil": 3, "clonotyp": [3, 4], "clonotype10": 2, "clonotype10_consensus_1": 2, "clonotype11": 2, "clonotype11_consensus_1": 2, "clonotype9": 2, "clonotype9_consensus_1": 2, "clonotype9_consensus_2": 2, "clonotype_network": [1, 4], "clonotypes_top10": 3, "close": [1, 4, 5, 8, 9, 11, 12, 13, 14, 15, 16, 19, 23, 24, 26, 28, 32, 36, 37, 38, 40, 41, 48, 49], "closer": [1, 11, 25], "closest": [11, 23, 49], "cloudpickl": 1, "clp": 50, "clr": [16, 27, 47], "clue_0": [8, 25], "clust_col": 36, "clust_label": 36, "cluster": [1, 2, 4, 7, 8, 9, 10, 11, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 49, 50, 51], "cluster_2": [8, 25, 27, 28], "cluster_co_occurr": 40, "cluster_color": 37, "cluster_interact": 40, "cluster_kei": [13, 40], "cluster_labels_r": 17, "cluster_nhood_enrich": 40, "cluster_numb": 3, "clustergrid": [1, 26], "clustermap": [4, 26], "clusters_coars": 51, "clusters_coarse_color": 51, "clusters_color": [50, 51], "clusters_top10": 3, "clustifyr": 5, "cm": 7, "cm_nsbm_level_0": 13, "cm_nsbm_level_1": 13, "cm_nsbm_level_2": 13, "cm_nsbm_level_3": 13, "cm_nsbm_level_4": 13, "cm_nsbm_level_5": 13, "cmap": [5, 7, 11, 15, 25, 26, 36], "cmd_bcr_embed": 3, "cmd_beniss": 3, "cmd_conga": 3, "cmd_conga_pp": 3, "cmd_ergo": 4, "cmd_tcrmatch": 4, "cmd_tessa": 3, "cmp": 5, "cmv": 4, "cner_1": 8, "cnt": 2, "co": [0, 4, 16, 17, 25, 26, 38, 48], "co_occurr": 40, "coach": 9, "coars": [5, 6, 33], "coarser": [5, 6], "coarsest": 23, "coat": [18, 24], "cobll1": [5, 12], "cobo": 17, "cocain": 16, "cocktail": 2, "coda": 13, "code": [1, 3, 4, 5, 7, 9, 10, 11, 13, 14, 18, 21, 22, 23, 24, 28, 38, 49, 50, 51], "codebas": 49, "codetool": [7, 21], "codetools_0": [8, 25, 27, 28], "codex": 39, "codi": 23, "codon": [1, 2, 18, 24], "coef": 14, "coeffici": [8, 13, 14, 16, 32], "cog": 5, "coher": 49, "cohort": 7, "coi": 17, "coin": 50, "coisb": [25, 50], "col": [4, 14], "col4a1": 38, "col4a4": [5, 12], "col_attribut": 26, "col_index": 21, "col_linkag": 4, "colab": 3, "coldata": [7, 8, 14, 17, 21, 34], "cole": [5, 7, 23, 44, 49], "coleman": [37, 41], "coli": 26, "colin": [2, 23], "collabor": [15, 21, 30], "collado": 26, "collaps": 23, "collat": [7, 21, 23], "colleagu": [24, 49], "collect": [2, 3, 4, 9, 13, 17, 19, 23, 24, 25, 26, 36, 41, 42, 51], "collection_dai": 2, "collier": 24, "collin": [2, 5, 7, 23, 50], "collis": 23, "colnam": [7, 8, 14, 15, 21, 25, 34], "colom": [7, 28], "color": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 31, 32, 34, 36, 37, 38, 41, 42, 43, 44, 45, 46, 49, 50, 51], "color_map": [33, 36, 50], "color_schem": 1, "colorama": [1, 7, 15, 21, 25], "colorbar_posit": 36, "colorbar_shap": 36, "colormap": [5, 7, 25, 36], "colorpalett": 8, "colorspac": [7, 21], "colorspace_2": [8, 25, 27, 28], "colour": [7, 8, 25], "colourmap": 38, "colpair": 21, "colq": 8, "colsum": 14, "column": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 32, 34, 36, 41, 49, 51], "column_cdr3a": 3, "column_cdr3b": 3, "column_names_gp": 8, "columnam": [10, 21], "com": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 43, 44, 45, 46, 47, 48, 49], "combat": 7, "combin": [1, 2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 17, 18, 23, 24, 27, 28, 31, 36, 37, 40, 48], "combinatori": [2, 16, 49], "combiz": [19, 29], "come": [1, 5, 7, 14, 15, 16, 19, 21, 24, 25, 36, 49], "comet": 3, "comet_workspac": 3, "comfort": [16, 21], "comm": 21, "comma": [2, 23], "command": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "comment": [3, 30, 50], "commerci": [9, 23, 24, 36, 39], "commod": 1, "common": [1, 2, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 27, 28, 34, 36, 39, 49, 50, 51], "common_idx": [27, 28], "commonli": [3, 4, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 33, 45], "commun": [0, 1, 2, 3, 5, 6, 9, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 29, 30, 31, 34, 36, 37, 39, 41, 47, 49, 50, 51], "comorbid": 17, "compact": [1, 9, 23], "compait82": 13, "compani": 24, "compar": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 31, 33, 34, 36, 37, 38, 41, 48, 49, 50, 51], "comparison": [4, 5, 6, 8, 11, 13, 14, 17, 18, 22, 23, 24, 25, 26, 31, 33, 36, 38, 49], "compart": [1, 17, 26], "compartment": 24, "compat": [1, 2, 5, 13, 15, 16, 28], "compbah19": 13, "compbst": 13, "compbuttneromul": 13, "compclo": 13, "compdht": 13, "compepgmfbarcelov03": 13, "compet": [1, 21], "competit": [1, 7, 15, 27], "compfrm": 13, "compgmpge17": 13, "comphbr": 13, "compil": [5, 26], "compiler_4": [8, 15, 25, 27, 28], "complement": [2, 22, 23, 43, 48], "complementari": [2, 8, 18, 22, 24, 25], "complet": [2, 3, 4, 5, 7, 13, 16, 17, 18, 19, 21, 24, 27, 29, 33, 44, 49], "complex": [1, 2, 4, 9, 13, 14, 16, 18, 19, 21, 23, 24, 25, 30, 31, 33, 36, 41, 43, 49], "complexheatmap": [8, 11, 25], "complexheatmap_2": [8, 25], "compliant": 4, "complic": [1, 5, 23], "complimentari": 25, "complp20": 13, "complrm17": 13, "compmgc21": 13, "compocm21": 13, "compon": [2, 5, 6, 9, 14, 16, 17, 18, 19, 23, 25, 31, 33, 34, 39, 41, 42, 45, 49, 50], "compos": [1, 7, 16, 23, 24, 25, 36], "composit": [1, 3, 5, 7, 17, 23, 24, 34, 36, 40, 41, 47, 49], "composition": 13, "compound": [16, 49], "comprehens": [7, 9, 14, 15, 17, 22, 23, 24, 25, 26, 28, 30], "compress": [3, 7, 13, 18, 19, 21], "compris": [16, 19], "compro10": 13, "compromis": [15, 23], "compssh": 13, "comput": [0, 1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 15, 16, 17, 18, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 44, 45, 50, 51], "computation": [1, 4, 11, 15, 19, 23, 24, 26, 31, 34, 38, 49], "compute_empirical_indel_prior": 49, "compute_expansion_pvalu": 49, "compute_expected_per_cell_typ": 36, "compute_motif": 1, "compute_pal_motif": 3, "compute_percent_indel": 49, "compute_percent_uncut": 49, "computesumfactor": 33, "compzjl": 13, "concat": [5, 7, 15, 27, 28, 38, 48], "concat_batch": 27, "concaten": [5, 7, 14, 15, 16, 19, 27, 28, 48], "concentr": [13, 25, 48], "concept": [1, 9, 17, 18, 19, 21, 23, 24, 25, 30, 33, 36, 37, 49], "conceptu": [16, 23, 25, 26], "concern": [15, 16, 23, 24, 25, 49], "conchola": 5, "concis": 23, "conclud": [15, 50], "conclus": [13, 14, 18, 23, 24, 51], "concord": [15, 16, 25], "cond": [5, 40], "conda": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "conda_prefix": 3, "conda_subdir": 23, "condit": [1, 2, 4, 7, 14, 15, 16, 17, 24, 25, 27, 28, 29, 30, 40, 46, 49], "condition_col": 25, "condition_color": [13, 15, 25], "condition_ind": 15, "condition_kei": [14, 16], "condition_label": 16, "conditioncontrol": 13, "conditionsalmonella": 13, "conditiont": 13, "conduct": [3, 4, 13, 14, 15, 16, 17, 19, 23, 24, 34, 36, 49], "conf_dict": 13, "conf_scor": 5, "confer": [7, 11, 27, 28, 34, 48, 49], "confid": [2, 4, 5, 13, 16, 21, 23, 24, 25, 26, 36, 49, 51], "config": 23, "configur": [2, 23], "configuration_valid": [28, 36], "configure_dataset": 27, "confin": 1, "confirm": [7, 17, 26, 40, 44], "conflict": 26, "confluenc": 49, "conform": [1, 8], "confound": [7, 13, 14, 16, 18, 33, 34], "confront": [14, 16], "confus": [21, 49], "conga_clone_fil": 3, "conga_gex": 3, "conga_results_summari": 3, "conga_tcr": 3, "conjug": [2, 48], "conjunct": 25, "conlon": 7, "connect": [2, 3, 4, 5, 6, 7, 13, 15, 18, 19, 21, 23, 25, 26, 27, 28, 36, 37, 38, 40, 43, 44, 45, 49, 50, 51], "connectionplot": 3, "connectom": 25, "connor": 1, "conor": 7, "conquer": 49, "conrad": [11, 17, 24, 26, 40], "consecut": 50, "consensu": [2, 5, 14, 41], "consensus_count": [1, 2], "consequ": [1, 8, 15, 23, 25, 38, 49, 50, 51], "conserv": [1, 4, 7, 13, 23, 28], "consid": [1, 3, 4, 5, 7, 8, 11, 13, 14, 15, 17, 19, 21, 23, 26, 34, 36, 37, 48, 49, 50, 51], "consider": [1, 2, 3, 11, 14, 23, 26, 49], "consist": [1, 2, 5, 6, 7, 13, 15, 17, 18, 19, 23, 24, 25, 26, 27, 37, 38, 40, 41, 48, 49, 51], "consol": [1, 11, 15, 17, 21], "consortia": 26, "consortium": [7, 18], "constant": [1, 4, 13, 18, 23, 32, 36, 51], "constantin": [29, 33], "constantli": 30, "constitut": [23, 24], "constrain": [4, 22], "constraint": [4, 13, 23], "construct": [1, 3, 4, 5, 7, 13, 14, 19, 21, 23, 25, 28, 30, 31, 34, 36, 49], "consult": [23, 30], "consum": [17, 18, 23, 24, 26, 34, 49], "contact": [4, 25], "contain": [1, 2, 3, 4, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 38, 39, 40, 41, 43, 44, 45, 46, 48, 49, 51], "contamin": [14, 23, 33, 34], "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "contenti": 5, "context": [2, 4, 5, 7, 13, 15, 18, 19, 23, 25, 26, 28, 31, 38, 39, 41, 51], "contextlib2": 7, "contextu": [16, 25], "contig": [2, 3], "contig_id": [2, 3], "contigu": 23, "continou": 4, "continu": [4, 5, 7, 11, 13, 14, 15, 16, 17, 21, 23, 27, 34, 36, 48, 49, 50, 51], "continuous_covariate_kei": [7, 36], "continuum": [5, 36, 49], "contol": 47, "contract": 23, "contradictori": 5, "contrari": [1, 4, 18, 24, 25, 47, 48], "contrast": [7, 13, 14, 15, 23, 24, 25, 36, 50], "contrastingli": [50, 51], "contribut": [0, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 43, 44, 45, 46, 47, 48, 49, 50], "control": [3, 6, 7, 8, 9, 13, 14, 16, 17, 18, 19, 24, 25, 26, 29, 30, 33, 36, 47, 49], "control_mark": 38, "control_p1": 36, "convei": 23, "conveni": [3, 4, 5, 7, 16, 19, 21, 23, 26, 33, 37, 38, 41, 49], "convent": [4, 13, 21, 48, 49], "converg": [3, 7, 8, 23, 28, 36, 44], "convers": [1, 5, 7, 11, 13, 14, 18, 21, 28], "convert": [1, 2, 4, 7, 11, 13, 14, 17, 21, 23, 24, 25, 26, 28, 33, 38, 49], "convert_alleletable_to_character_matrix": 49, "convertformat": 21, "convolut": [37, 41], "coo_matrix": 28, "cookson": 17, "cooper": 2, "coordin": [5, 14, 19, 21, 23, 24, 25, 28, 36, 37, 38, 40, 41, 51], "copi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "cops5": 41, "corbett": 34, "corc": 9, "corcoran": 1, "core": [1, 4, 5, 7, 8, 11, 13, 16, 19, 21, 23, 25, 26, 27, 28, 36, 40, 41, 50, 51], "core_2": 27, "coreceptor": 4, "corefound": 21, "cork": 24, "corleon": 14, "corman": [17, 26], "cornal": 37, "corneliu": 24, "corner": [11, 14, 51], "coronaviru": [2, 4], "corpor": 31, "corr": [8, 38], "corr_method": 41, "corrada": [19, 22], "corrcoef": 17, "correct": [1, 2, 4, 5, 10, 11, 14, 15, 18, 21, 24, 26, 27, 28, 33, 36, 37, 41, 42, 45, 49], "correct_answ": 42, "correctli": [5, 7, 11, 17, 21, 23, 24, 36, 49], "correl": [1, 3, 8, 11, 13, 14, 15, 16, 17, 18, 19, 23, 25, 26, 38, 41, 48, 51], "correspond": [1, 3, 4, 5, 7, 9, 11, 13, 14, 16, 18, 19, 23, 24, 25, 27, 28, 30, 34, 37, 38, 45, 49, 50, 51], "correspondingli": [19, 23, 25], "corrupt": 23, "cortex": [16, 37, 40, 41], "cortex_1": 40, "cortic": 24, "coscia": 29, "cosin": [16, 27, 38, 51], "cospar": 49, "cost": [4, 13, 16, 21, 23, 24, 25, 31], "costa": [25, 36], "cotl1": [5, 12], "could": [0, 1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 19, 23, 24, 25, 26, 27, 28, 29, 34, 37, 38, 41, 43, 44, 46, 48, 49], "coulthard": 50, "count": [2, 3, 4, 5, 7, 8, 9, 14, 15, 16, 17, 18, 19, 21, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "count_cutoff_low": 11, "count_mat": 3, "count_nhood": 13, "counter": 4, "counts_df": 15, "counts_mat": 21, "counts_per_cell_aft": [17, 19], "coupl": [1, 2, 25, 34, 45, 51], "cours": [13, 19, 23, 25, 36], "courtin": [14, 16], "courtnei": [43, 49], "cov": [2, 3, 4, 7], "cov1": 4, "cov2": 4, "cov2_alpha": 4, "cov2_beta": 4, "cov2_g": 4, "cov2_gamma": 4, "cov2_wt": 4, "cov_abdab": 4, "cov_plot": 10, "covabdab": 4, "coval": 48, "covari": [7, 13, 14, 27, 28, 33, 34, 36, 41], "covariate_1": 13, "covariate_2": 13, "covariate_matrix": 13, "covariate_ob": 13, "cover": [3, 11, 19, 22, 23, 24, 25, 47], "coverag": [8, 10, 15, 22, 23, 24, 26, 27, 48], "coverageplot": 10, "covid": [1, 2, 3, 4, 15, 26], "cowplot": [7, 8, 21], "cowplot_1": [8, 25, 27, 28], "cowplot_mono": 8, "coxhead": 50, "cp": 15, "cpa6": 41, "cpdbv2": 25, "cpg": [9, 18, 24], "cpm": [15, 17, 21, 27, 28, 32, 33], "cpne7": 41, "cptp": 3, "cpu": [1, 5, 14, 15, 27, 28, 36, 38], "cr": 23, "cr1": 27, "cr1l": 8, "cr2": 27, "cracd": 12, "craft": 4, "craig": [14, 49], "cramer": [50, 51], "cran": [7, 21], "crash": 7, "crawford": [3, 4], "crayon_1": [8, 25, 27], "crc": 40, "crd3\u03b2": 4, "cre": 49, "creasei": 50, "creat": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "createassayobject": [27, 28], "createchromatinassai": 10, "createcistopicobject": 8, "creation": 23, "credenti": 2, "credibl": 13, "credible_effect": 13, "credit": 9, "crespo": 25, "cribb": 24, "crick": 24, "crinklaw": 4, "crisi": 2, "crispr": 49, "cristina": [14, 15, 16, 25], "criteria": [17, 49], "criterion": [8, 23], "critic": [1, 2, 14, 18, 23, 24, 25, 30, 49], "crmeth": 48, "cross": [2, 5, 16, 23, 25], "crosstab": 5, "crosstalk": 25, "crotti": 2, "crowd": 14, "crowlei": 47, "crtam": 5, "crucial": [5, 7, 9, 11, 15, 17, 23, 24, 25, 34], "csbj": [5, 39], "csc": 33, "cse63": 49, "csf3r": [5, 12], "csg": 49, "csl": 43, "csr": 25, "csr_matrix": [4, 5, 15, 19, 21, 33], "cst3": [5, 12, 19], "csv": [2, 3, 4, 11, 14, 21, 26, 36], "csvwtgegytf": 4, "csvytgtsayeqyf": 4, "cswlagqetqyf": 4, "ct": [5, 14, 19], "ct_count": 17, "ct_marker": 5, "ct_order": 5, "ct_to_keep": 17, "ctacctcagacaccgc": 7, "ctcccaatccattgga": [27, 28], "ctctg": 49, "ctctgaattc": 49, "ctggcaggtctcacgg": 28, "ctggtctcatccttgc": 3, "ctla4": 27, "ctor": 26, "ctrl": [14, 16, 25, 50], "ctrl_adata": 16, "ctrl_kei": 16, "ctsb": 8, "ctsrmdsnygytf": 4, "cttcaattcacgaatc": 7, "ctttgcgagctgccca": 3, "ctx": 26, "ctype": [7, 21], "cu459201": 19, "cuda": [3, 5, 27, 28, 36, 38], "cuda_visible_devic": [5, 27, 28, 36], "cui": [1, 25], "cultur": 24, "cumul": [23, 49], "cuoco": [7, 16], "cuomo": 7, "cupi": 28, "curat": [4, 5, 15], "curious": 1, "currcel": 17, "current": [3, 7, 8, 9, 10, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 29, 30, 41, 49, 50, 51], "curri": 49, "curti": 1, "curv": [1, 3, 8, 14, 16, 25, 26, 36, 50], "curve_layout": [1, 3], "custom": [4, 7, 19, 21, 26], "cut": [8, 11, 13, 14, 19, 24, 30, 41, 49], "cutoff": [4, 8, 13, 17, 34, 48], "cutrat": 49, "cv0902": [1, 4], "cvae": 7, "cvejic": 24, "cvfgfrgdtqyf": 4, "cvsrdkyeqyf": 4, "cvtegssyneqff": 4, "cvtglaentqyf": 4, "cvtretggggytf": 4, "cvtrysyeqyf": 4, "cvvrapwgsarqltf": 4, "cxcl10": 25, "cxcl11": 25, "cxcr5": 27, "cyb": 7, "cycif": 39, "cycl": [5, 6, 16, 18, 23, 24, 36, 51], "cycler": [1, 7, 15, 21, 25], "cyclic": 50, "cynomolgu": 1, "cynthia": 24, "cython_runtim": [1, 7, 15, 21, 25], "cyto": 6, "cytof": 17, "cytokin": [1, 2], "cytomegaloviru": 4, "cytometri": [1, 2, 6, 13, 17, 48], "cytoolz": 26, "cytoplasm": [18, 34], "cytosin": 18, "cytoskeleton": 24, "cytotalk": 25, "cytotox": 5, "d": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 33, 34, 38, 48, 49, 50, 51], "d0": 2, "d000": 2, "d018": 2, "d1": [4, 15, 26], "d100": 26, "d2": [7, 19], "d3": 8, "d419": 4, "d427": 4, "d721": 15, "d728": 15, "d93": 26, "d95f02": 7, "d_": 38, "d_c": 36, "d_call": 1, "d_call_b_vdj": 1, "d_call_vdj": 1, "d_cigar": 1, "d_gene": 2, "d_i": 36, "d_j": 38, "da": [7, 13, 14, 23, 50, 51], "da_nhood": 13, "dabrowska": 50, "dac": 16, "dafni": [8, 9], "dahlin": [6, 50], "dai": [13, 16, 17, 19, 37], "daigl": 24, "daines": 50, "dalmia": 17, "damag": [2, 16, 19, 23], "damian": 15, "damiano": 2, "damien": 28, "dan": [19, 22, 25, 49], "dana": [5, 7, 16, 23, 50, 51], "dandelion": 2, "dandelion_define_clones_heavi": 1, "danes": [7, 28], "dang": [17, 26], "danger": 13, "daniel": [1, 2, 3, 5, 7, 9, 11, 13, 15, 17, 22, 23, 24, 25, 26, 27, 28, 34, 43, 44, 45, 46, 47, 48, 49, 50], "daniela": [17, 26], "danielsson": 24, "danila": [19, 28, 48], "dann": [13, 36, 50], "danyi": 3, "darbi": [5, 14, 19, 27, 28], "darmani": 24, "darrel": 49, "darren": 24, "darwin13": [7, 15, 21], "dash": [3, 4, 21, 23, 51], "dask": 1, "dasom": 26, "data": [0, 4, 6, 8, 11, 12, 14, 18, 22, 24, 25, 29, 30, 31, 32, 33, 43], "data_3": [25, 27, 28], "data_dir": 51, "data_fil": 17, "data_load": 4, "data_mat": [11, 33, 34], "data_tod": 34, "databas": [2, 3, 15, 23, 25, 26], "datafram": [1, 2, 3, 4, 11, 13, 14, 15, 17, 21, 25, 26, 27, 28, 38, 41, 49], "dataload": 16, "datapoint": [39, 51], "dataset": [3, 4, 5, 6, 8, 9, 10, 13, 15, 17, 18, 19, 21, 23, 25, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 43, 45, 47, 48, 49, 50, 51], "dataset_id": [7, 27, 28], "dataset_nam": 27, "dataset_name_fin": 27, "datastructur": [1, 2, 3, 4], "datat": 14, "date": [1, 2, 4, 5, 7, 9, 21, 22, 26, 30], "date_of_sampl": 17, "dateutil": [1, 7, 15, 21, 25], "datset": 5, "daughter": 49, "daughton": 2, "daunt": 49, "dave": 50, "davi": [4, 5, 8, 9, 14, 15, 19, 22, 23, 24, 49], "david": [1, 3, 5, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 29, 36, 37, 40, 41, 49, 50, 51], "davidi": 38, "davidson": 5, "davislaboratori": 15, "dawei": [7, 50], "dawoud": 2, "day10": 13, "day3": 13, "day_color": 51, "daya": 5, "days_after_onset": 17, "days_from_onset": 2, "daza": [16, 49], "db": [1, 4], "db88": 4, "db_3": 8, "db_glob": 26, "db_name": 26, "dbdimitrov": 25, "dbi_1": 8, "dbl": [10, 25], "dbl_score": 11, "dc": [5, 15, 25, 50], "dc1": 5, "dc2": 5, "dc3": 5, "dclear": 49, "ddj09": 49, "ddl": 1, "de": [2, 5, 7, 11, 14, 15, 16, 17, 25, 26, 27, 28, 30, 31, 34, 48, 49, 50], "de_d": 25, "de_edger_": 14, "de_per_cell_typ": 14, "de_res_to_anndata": 14, "dea_leiden_2": 5, "dea_leiden_2_filt": 5, "dead": [19, 24], "deal": [1, 2, 7, 17, 19, 36, 47, 48], "dean": [4, 5, 7, 50], "death": [2, 16], "debat": 9, "debh95": 14, "debkvb": 14, "debnath": 40, "debora": 16, "deborah": 50, "debri": 23, "debug": 3, "debugpi": [1, 7, 15, 21, 25], "dec": [13, 14, 16, 17, 23, 24, 32, 44, 49], "decad": [0, 49], "decai": 37, "decemb": [5, 7, 9, 14, 23, 34, 39, 51], "decent": 15, "decid": [2, 7, 11, 13, 21, 48], "deciph": [3, 16, 24, 25, 39, 41, 50], "decis": [3, 4, 5, 16, 19, 28, 34, 50], "decitabin": 16, "declan": 51, "declar": [8, 26], "decod": [16, 27], "decoi": [17, 26], "decompos": [28, 36, 39, 41], "decomposit": [7, 19, 36], "decompress": [23, 37], "decompressionbombwarn": 37, "deconinck": [7, 11, 27, 28, 34, 48, 50], "decontamin": 34, "decontx": 34, "deconvolut": [23, 25, 33, 38, 39], "deconvolution_": 36, "deconvolution_book": 36, "deconvolv": [36, 39, 49], "deconvseq": 17, "decor": [1, 4, 7, 15, 21, 25], "decoupl": 25, "decovolut": 17, "decovolv": 17, "decreas": [7, 8, 11, 13, 15, 18, 23, 24, 31, 36, 51], "dedic": [19, 30, 34, 49], "dedrm": 14, "deduc": [13, 38], "deduct": 4, "dedupl": 23, "dee": 24, "deeg": [23, 24], "deem": [23, 24, 48], "deep": [3, 4, 5, 7, 9, 16, 17, 21, 23, 24, 27, 28, 38, 44, 49, 51], "deepen": 30, "deeper": [30, 38, 48], "def": [4, 13, 14, 15, 19, 25, 27, 34, 42, 48, 49], "default": [1, 3, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 19, 21, 23, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 41, 49, 51], "default_embed": 36, "default_gener": [19, 21], "default_rng": 19, "defaultassai": [10, 27, 28], "defb1": 14, "defect": 24, "defens": 1, "defin": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 15, 16, 17, 18, 19, 21, 23, 26, 29, 31, 34, 36, 40, 41, 47, 49, 50, 51], "define_clon": 1, "define_clonotyp": 3, "define_clonotype_clust": [1, 4], "defineclon": 1, "definit": [3, 4, 5, 7, 13, 23, 24, 25, 49], "defmi": 14, "deform": 24, "defusedxml": [1, 7, 21, 25], "deg": [3, 4, 14, 16, 25], "degrad": [18, 24, 34, 51], "degre": [2, 3, 4, 16, 23, 24, 33], "dehhan": 14, "dehtti17": 14, "dejse22": 14, "dejseyetermdnasrollahme16": 14, "dekst": 14, "del": [5, 7, 26, 28, 33, 34], "delahnemannkost": 14, "delai": [8, 48], "delayedarrai": [7, 21], "delayedarray_0": [8, 15, 27, 28], "delayedmatrixstats_1": 8, "deldir": [7, 21], "deldir_1": [25, 27, 28], "delet": [3, 4, 7, 18, 23, 28, 33, 34, 49], "delha14": 14, "delic": 30, "delimit": 18, "delin": 49, "deliveri": [24, 49], "delorei": [13, 22], "deloro": 28, "delt19": 14, "delta": [5, 16, 33, 49, 51], "delta_augur": 16, "delta_label": 37, "delv": [23, 49], "delzd": 14, "demand": 30, "demerdash": 51, "demix": 36, "demograph": 7, "demonstr": [1, 4, 7, 9, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 49], "dems22": 14, "demultid": 17, "demultiplex": [3, 18, 23], "den": [5, 7, 26], "dendrid": 43, "dendrit": [14, 16, 25], "dendritic_cel": 14, "dendrogram": [5, 13, 16, 26], "dendrogram_cell_typ": 26, "dendrogram_celltypist_cell_label_fin": 5, "dendrogram_leiden": 43, "dendrogram_leiden_2": 5, "dendrogram_mixscape_class": 16, "dene": [15, 26], "deng": [2, 7, 14, 15], "deni": [16, 36], "denis": 7, "denisenko": 25, "denni": [2, 17, 23], "denois": [19, 47], "denot": [5, 15, 16, 18, 25, 49], "dens": [5, 6, 19], "densiti": [4, 11, 13, 38], "density_prior": 38, "densli": 9, "dentate_gyru": 40, "dentro": 49, "denv2": 4, "deoxyribonucl": [18, 24], "depasqual": 23, "depend": [2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "depict": 9, "deplanck": 50, "deplet": [13, 16, 40], "deploi": 49, "deprec": [4, 5, 6, 7, 10, 13, 15, 19, 27, 28, 34], "deprecationwarn": [5, 7, 28], "deprez": 7, "depth": [5, 7, 11, 14, 22, 25, 33, 34, 36, 40, 49], "depth_first_traverse_nod": 49, "derek": 15, "deriv": [1, 2, 3, 4, 6, 8, 11, 13, 15, 16, 18, 19, 23, 25, 28, 48, 49], "derms10": 14, "derpw": 14, "desai": [5, 7, 50], "desc": 25, "descend": [23, 49], "descent": 31, "describ": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 31, 32, 33, 34, 36, 37, 38, 39, 44, 48, 49, 50, 51], "descript": [3, 4, 7, 18, 19, 23, 25], "deseq2": 14, "desgk": 14, "desig": 15, "design": [1, 2, 3, 4, 7, 13, 14, 16, 17, 21, 22, 23, 24, 25, 28, 30, 33, 41, 44, 45, 49], "desir": [4, 13, 15, 16, 21, 23, 24], "despit": [1, 2, 15, 16, 22, 23, 37], "desr18": 14, "dest": 21, "destroi": [50, 51], "destruct": [16, 51], "destvi": 36, "detail": [0, 1, 2, 3, 4, 5, 6, 7, 11, 14, 15, 16, 19, 21, 22, 23, 24, 25, 27, 28, 30, 34, 36, 38, 43, 44, 49, 51], "detect": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 18, 19, 21, 24, 26, 32, 36, 38, 41, 48, 49, 51], "detection_alpha": 36, "detector": 24, "determin": [2, 3, 4, 6, 7, 8, 9, 13, 14, 15, 17, 18, 23, 24, 25, 26, 28, 33, 36, 37, 49], "determinist": [38, 51], "detomaso": 15, "detrcp21": 14, "detriment": [2, 13], "detweil": [7, 11, 27, 28, 34, 48], "deutsch": [17, 26], "dev": [5, 28, 51], "dev169730": 49, "dev200877": 49, "develop": [0, 2, 3, 4, 7, 11, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 29, 30, 31, 37, 39, 44, 50, 51], "development": [2, 8, 13, 18, 23, 27, 49, 50, 51], "development_stag": 36, "devianc": 32, "deviancefeatureselect": 32, "deviant": [5, 31, 32], "deviat": [2, 14, 15, 21, 23, 34, 41], "devic": [18, 27, 38, 49], "devlin": 1, "devr": 14, "devtool": [8, 11, 27, 28], "dewitt": 49, "dewlnn19": 14, "dexter": 49, "dezel21": 14, "df": [1, 8, 13, 14, 17, 21, 50], "df_bcr": 3, "df_bcr_contig": 3, "df_bcr_raw": 2, "df_count": 3, "df_dist": 4, "df_dist_alpha": 4, "df_dist_beta": 4, "df_donor": 14, "df_ergo": 4, "df_patient": 2, "df_sequenc": 3, "df_tcr": 3, "df_tcr_ergo": 4, "df_tcr_raw": 2, "df_tcrdist": 4, "df_tcrdist_alpha": 4, "df_tcrdist_beta": 4, "df_tcrmatch": 4, "dfgh": [3, 4], "dgcmatrix": [7, 10, 21], "dge": 14, "dgelist": 14, "dhanda": 4, "dhaval": 7, "di": [1, 11, 14, 15, 25, 37], "diag_edg": 27, "diagnosi": 17, "diagnost": [13, 23, 48], "diagon": [13, 16, 23, 36], "diagramm": 25, "diagrammer_1": 25, "diamet": 36, "dian": 49, "diaz": 49, "dicekrig": 25, "dict": [3, 4, 13, 42], "dict_renam": 4, "dict_rename_cov_abdab": 4, "dict_rename_tcrdist": 4, "dictionari": [3, 5, 19, 27, 30], "did": [7, 14, 15, 16, 21, 27, 28, 34, 41, 48, 49], "didn": [5, 7], "diehn": 17, "dielectr": 2, "diem": 23, "dieter": [17, 26], "dietmar": [2, 13, 19], "dietrich": [17, 26], "diez": 24, "diff": [5, 16], "diff_gen": 16, "differ": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 14, 15, 16, 17, 18, 19, 21, 22, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 41, 43, 44, 45, 47, 48, 49, 50, 51], "differenti": [1, 3, 9, 15, 19, 23, 26, 33, 38, 39, 41, 48, 49, 50, 51], "difficult": [3, 5, 7, 13, 21, 23, 24, 26, 43, 49], "diffmap": 50, "diffobj": 25, "diffus": [25, 41, 50], "digest": [7, 21, 24, 49], "digest_0": [8, 25, 27, 28], "diggl": 40, "digit": [14, 16, 17, 23, 24, 49], "digraph": 18, "dijk": [13, 16], "dillman": 17, "dilmtqspssmsvslgdtvsitchasqgigsnigwlqqkpgksfkg": 4, "dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfkg": 4, "dilut": 34, "dim": [7, 8, 14, 17, 21, 27, 28], "dimens": [3, 5, 7, 8, 13, 14, 16, 18, 19, 21, 26, 28, 31, 32, 34, 38, 45, 50], "dimension": [3, 4, 5, 6, 7, 9, 10, 11, 13, 16, 17, 19, 21, 27, 28, 33, 34, 37, 41, 49, 50, 51], "dimitrio": 1, "dimitrov": [15, 25], "dimmel": 23, "dimnam": 11, "dimplot": [10, 27], "dinar": 23, "dine": 4, "ding": [24, 48], "dionn": [13, 22, 50], "diploid": [9, 11], "dir": [8, 23], "direct": [4, 13, 15, 18, 21, 23, 24, 25, 26, 50], "direction": 25, "directli": [1, 2, 3, 4, 5, 7, 11, 15, 16, 17, 19, 21, 23, 24, 26, 32, 33, 36, 37, 39, 40, 51], "directori": [3, 5, 11, 21, 23, 27, 50], "dirichlet": [8, 13], "dirichletmultinomial_1": 8, "dirk": 9, "disadvantag": [5, 25], "disassoci": 51, "discard": [1, 2, 16, 23, 31], "discern": [2, 13, 16], "disclaim": 8, "discourag": 21, "discov": [7, 8, 13, 17, 24], "discover": 1, "discoveri": [1, 4, 13, 14, 16, 23, 29, 30, 38, 49], "discrep": [13, 23], "discret": [13, 14, 18, 50], "discrimin": 23, "discuss": [2, 4, 5, 7, 11, 13, 15, 19, 21, 24, 26, 27, 28, 29, 30, 48, 49], "diseas": [1, 2, 3, 4, 5, 7, 9, 13, 14, 15, 16, 17, 18, 24, 25, 29, 30, 36, 48, 49, 50, 51], "disease_stag": 17, "diseased_sampl": 13, "diseased_tissu": 13, "disentangl": [9, 25, 28], "disk": [18, 19], "disord": 24, "dispar": [24, 49], "dispatch": 21, "dispers": [7, 13, 14, 17, 21, 27, 28, 32, 36, 38], "dispersions_norm": [7, 13, 17, 21, 27, 28], "displai": [1, 3, 6, 7, 13, 23, 34, 36, 42], "displot": [4, 34, 48], "dispos": 49, "disrupt": 30, "dissect": [15, 26], "dissimilar": [25, 49], "dissoci": [7, 24, 25, 36, 38, 39, 49], "dissociation_scor": 36, "dissolv": [9, 24], "dist": 4, "dist_tcrmatch": 4, "dist_tot": 4, "dist_valu": 4, "distal": [5, 8, 11, 26, 50], "distanc": [1, 2, 3, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 21, 23, 27, 28, 31, 36, 37, 38, 40, 41, 43, 44, 45, 49, 51], "distant": [16, 25], "distinct": [5, 7, 9, 11, 13, 15, 16, 17, 23, 24, 25, 30, 36, 41, 49], "distinctli": 13, "distinguish": [5, 11, 13, 16, 23, 24], "distort": [11, 18, 23, 34], "distplot": [4, 26], "distribut": [1, 3, 4, 7, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 34, 36, 38, 41, 46, 47, 48, 49, 50], "div": 42, "diverg": [3, 4, 23, 38], "divers": [2, 3, 5, 7, 9, 13, 23, 24, 25, 30, 39, 49, 50], "divid": [3, 7, 8, 9, 11, 17, 18, 19, 23, 24, 26, 36, 37, 47, 49], "divis": [1, 24, 49], "divmtqshkfmstsigdrvsitckashdvstavawyqqkpgqspkl": 4, "dixon": 50, "diya": 50, "djambazian": 23, "djamel": 11, "djekidel": 16, "dl": 7, "dmap": 17, "dmitri": [16, 31], "dmitrii": 4, "dmitryulyanov": 3, "dmxl2": [5, 12], "dna": [7, 8, 9, 11, 14, 18, 23, 24, 26, 27, 28, 30, 34, 37, 48, 49, 51], "dnaja1": 8, "dnajc6": 12, "dnph1": 8, "dntt": [5, 12], "do": [1, 2, 3, 4, 5, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 27, 28, 29, 33, 36, 37, 39, 45, 46, 48, 49, 51], "doan": 49, "dobin": 23, "doc": [1, 21], "dock": 4, "docrep": 7, "document": [1, 2, 3, 4, 19, 21, 23, 25, 34, 36, 42, 49, 50], "doe": [1, 2, 3, 4, 5, 6, 7, 9, 10, 13, 14, 15, 16, 19, 21, 22, 23, 24, 25, 31, 34, 36, 38, 41, 45, 48, 51], "doesn": [3, 4, 7, 13, 16, 21, 26], "dogma": [48, 50], "doheon": 15, "doherti": 23, "doi": [2, 4, 5, 6, 7, 9, 11, 13, 14, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "dolrt": 14, "dolton": 4, "domain": [8, 25, 41, 50], "domani": 51, "domck": 49, "domenico": [17, 26], "domin": [1, 3, 7, 15, 24, 26, 31], "dominik": [7, 11, 13, 27, 28, 34, 48, 51], "dom\u00ednguez": 5, "don": [5, 7, 11, 13, 15, 23, 32, 47, 48], "donaghi": 51, "donald": [23, 24, 49], "done": [1, 3, 5, 7, 8, 11, 13, 15, 16, 18, 21, 24, 26, 27, 28, 36, 38, 40, 41, 47, 49, 51], "dong": [5, 14, 16, 23, 25, 37, 39, 50], "dongen": [7, 25], "donghyun": 26, "dongq": 25, "dongz": [23, 51], "doni": [5, 7, 50, 51], "donno": [5, 7, 16, 50], "donor": [3, 4, 5, 7, 8, 14, 15, 17, 19, 26, 27, 28, 34, 43, 44, 45, 46, 47, 48], "donor8": [5, 6], "donor_": 14, "donor_color": [27, 28, 43, 44, 45], "donor_id": 36, "donor_kei": 14, "donorag": [7, 27, 28], "donorbloodtyp": [7, 27, 28], "donorbmi": [7, 27, 28], "donorgend": [7, 27, 28], "donorid": [7, 27, 28], "donornumb": [7, 27, 28], "donorrac": [7, 27, 28], "donors_to_drop": 14, "donorsmok": [7, 27, 28], "doolei": 49, "doparallel": 8, "doparallel_1": [8, 25], "doplot": 34, "dorc": 8, "dorcg": 8, "dorcgen": 8, "dorcjplot": 8, "dorcmat": 8, "dorctab": 8, "dorfman": 33, "dori": 15, "dorin": 50, "dormant": 1, "dorothea": [15, 26], "dose": 16, "dosnow_1": 8, "dot": [4, 11, 13, 19, 23, 25, 36, 38], "dotplot": [5, 25, 43], "dott": 15, "dou": [25, 49], "doubl": [5, 11, 13, 23, 48], "doublet": [2, 3, 4, 16, 18, 31, 33, 36, 48], "doublet_class": 34, "doublet_scor": [11, 34, 36], "doubletdecon": 23, "doubletfind": 23, "doublets_mark": [44, 45, 46], "doublets_markers_color": [44, 45, 46], "dougla": [5, 7, 15, 17, 48, 50], "douw": 7, "down": [1, 5, 7, 9, 13, 14, 15, 26, 49], "downgrad": 1, "download": [2, 3, 4, 5, 8, 11, 15, 16, 19, 21, 23, 25, 26, 36, 50], "download_model": 5, "downregul": 14, "downsampl": [2, 3, 4], "downsamplingindex": 17, "downsamplings": 17, "downstream": [2, 3, 5, 7, 8, 11, 18, 19, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 40, 41, 49, 51], "dpi": [1, 6, 11, 15, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "dplyr": [7, 8, 11, 21, 25], "dplyr_1": [8, 25, 27, 28], "dpp4": 27, "dpt": 50, "dpt_pseudotim": 50, "dr": [17, 25, 27, 37, 49], "dra": [25, 27], "dramat": 1, "drastic": 23, "draw": [2, 8, 16, 23, 24, 49, 51], "drawback": [21, 23], "drawn": [5, 11, 49], "dream": [0, 49], "drenkow": 23, "drew": [17, 26], "dri": 37, "dric": 2, "drive": [5, 9, 26, 50], "driven": [9, 13, 15, 24, 25], "driver": [8, 49], "drop": [2, 3, 4, 5, 7, 11, 14, 15, 18, 23, 24, 25, 34, 36, 49, 51], "drop_dupl": [2, 3, 4, 25, 49], "drop_na": 25, "dropkick": 23, "droplet": [2, 9, 11, 14, 15, 16, 18, 24, 25, 34, 46, 47, 48], "dropletqc": 23, "dropletutil": 23, "droplevel": 15, "dropna": [1, 28], "dropout": [3, 14, 18, 31, 38], "dropout_r": 7, "dropseq": 23, "drost": [3, 4], "drosten": [17, 26], "drs18": 6, "drug": [13, 14, 16, 24], "dry": 24, "ds_g": 51, "dsb": 48, "dsc_loss": 27, "dscmatrix": 10, "dscrna": [23, 51], "dst": 1, "dt": [13, 16, 51], "dt_0": 8, "dtangl": 17, "dtgr": 25, "dtype": [1, 2, 4, 5, 7, 11, 13, 15, 16, 17, 19, 21, 25, 26, 27, 28, 32, 34, 40, 45, 47, 49], "dtypewarn": [1, 2, 3, 49], "du": [4, 6, 17], "du_g": 51, "dual": [2, 23, 49], "dual_ir": [1, 3, 4], "duan": 15, "duart": 8, "dublet": 2, "duccio": 38, "duclo": 7, "ductal": 51, "dudoit": [14, 50], "due": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 21, 23, 24, 26, 28, 29, 31, 33, 34, 36, 43, 44, 46, 47, 48, 49, 51], "duga": [7, 28], "dugourd": [15, 25], "duhe": 50, "dui": 37, "dummi": [7, 13, 36], "dummy_confound": 13, "dunamai": [15, 25], "duong": [5, 7, 15, 50], "dupag": 49, "duplic": [3, 4, 11, 15, 18, 21, 23, 24, 34], "duplicate_count": 1, "duplicate_count_b_vdj": 1, "duplicate_count_b_vj": 1, "dure": [1, 2, 3, 4, 7, 8, 11, 13, 16, 18, 23, 24, 26, 27, 28, 30, 31, 33, 34, 45, 48, 49, 51], "durik": 51, "dusp22": 12, "dutilh": 14, "duygu": 11, "dv5": 1, "dv8": 4, "dvir": 17, "dwl": 17, "dx": [13, 25], "dy": [19, 34], "dye": 24, "dykstra": 49, "dylan": [5, 36], "dylib": [13, 15], "dynam": [1, 18, 23, 24, 25, 31, 48, 50, 51], "dynguidelin": 50, "dysregul": [17, 26, 30], "d\u00e9ne": 25, "e": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 36, 37, 39, 40, 45, 46, 49, 50, 51], "e1000217": 15, "e1005803": 1, "e1008585": 23, "e1009290": 23, "e1010031": 51, "e107": 38, "e1071_1": 25, "e10798": 29, "e11": 40, "e12": 24, "e1364": 24, "e14": 38, "e17": 5, "e21": [7, 37], "e2100293118": 13, "e23": [17, 26], "e29": [5, 27, 28], "e2f2": 38, "e34e908": 21, "e4": [23, 24], "e42": 7, "e47": [14, 15], "e5": [23, 24], "e50": 36, "e6": [5, 34], "e66": 25, "e6v": 24, "e8": 23, "e8746": [14, 22], "e9": 23, "e9620": 7, "e_g": 36, "eaat9804": 49, "eaaw3381": 49, "eaaw8151": 43, "eaba2619": 17, "eabb3099": 49, "eabc1944": 49, "eabl5197": 5, "each": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 47, 48, 50, 51], "earl": 8, "earli": [3, 5, 8, 13, 14, 15, 16, 17, 19, 23, 24, 27, 28, 29, 30, 37, 41, 47, 48, 49, 50, 51], "earlier": [3, 4, 5, 7, 16, 19, 23, 24, 32, 44, 48, 49], "early_stop": [7, 16, 27], "early_stopping_pati": 16, "earlystop": 27, "eas": 5, "easi": [0, 1, 5, 13, 21, 36, 38], "easier": [1, 3, 5, 7, 16, 21, 24, 36, 49], "easiest": [3, 13], "easili": [1, 2, 3, 4, 13, 16, 19, 21, 23, 24, 33, 37, 38, 49], "ebay": 14, "ebert": 15, "ebf1": [5, 12], "ebi": 3, "ebv": 4, "ec": 23, "eccit": 16, "eck": [5, 6, 50], "ecker": 9, "economo": 24, "ecosystem": [7, 13, 16, 18, 19, 22], "ed": [23, 24], "eda": 14, "edg": [1, 7, 8, 13, 18, 23, 26, 27, 30, 49], "edgel": 13, "edger": [13, 15], "edger_": 14, "edger_3": 15, "edger_b_cel": 14, "edger_cd14_monocyt": 14, "edger_cd4_t_cel": 14, "edger_cd8_t_cel": 14, "edger_dendritic_cel": 14, "edger_fcgr3a_monocyt": 14, "edger_nk_cel": 14, "edges_width": 1, "edgeweight": 1, "edit": [1, 4, 16, 18, 23, 49], "editor": [7, 30, 50], "edouard": 7, "eduard": 24, "eduardo": [5, 7, 23, 51], "edward": [15, 37, 41, 49], "ee4b2b": 42, "eef1a1": 16, "eeshit": 7, "efbbcmfz2mmc": 40, "effect": [0, 5, 7, 9, 11, 14, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 38, 44, 46, 48, 49, 50, 51], "effect_df_condit": 13, "effect_nam": 13, "effective_plast": 49, "effector": [1, 3, 5, 12], "effects_bar_plot": 13, "efficaci": [16, 23], "effici": [4, 5, 6, 7, 14, 16, 18, 21, 23, 24, 30, 31, 34, 36, 39, 41, 47, 49, 50, 51], "effort": [0, 7, 13, 19, 23, 26, 29, 49], "efremova": [25, 50], "efthymia": [5, 7, 14, 16, 19, 27, 28, 48, 50], "eg": 7, "egg": 49, "egorov": 4, "egozcu": 13, "egr1": 12, "eharpi": 17, "ehsan": [17, 26], "eickelberg": [5, 7, 50], "eight": [13, 16, 34], "eil": 40, "eileen": 8, "einhard": 49, "eiru": 26, "either": [1, 2, 3, 4, 7, 8, 10, 11, 13, 14, 17, 19, 21, 23, 24, 25, 28, 29, 32, 34, 38, 39, 47, 48, 49, 51], "ekaterina": 4, "el": 3, "el7": 1, "elabor": [5, 24, 34, 39], "elac019": 25, "elaps": [7, 8, 27], "elbo_train": 36, "elbo_valid": [16, 27], "elbow": 23, "eldj": [23, 51], "electr": 24, "electrochem": 9, "electrophoresi": 24, "elegan": 49, "elem": 7, "element": [2, 4, 7, 8, 11, 13, 19, 21, 23, 24, 26, 34, 42], "elena": [7, 17, 25, 26, 50], "eleni": [5, 14, 16, 19, 27, 28, 48, 50], "elev": 3, "elevated_ifng": 3, "eleven": 14, "elhanati": 1, "elicit": 25, "elif": 5, "elimin": [23, 24], "elior": 23, "elisa": [13, 50], "elisabetta": [15, 24, 36], "eliza": 24, "elizabeth": [5, 7, 14, 15, 16, 24, 25, 36, 48, 50], "elliott": 50, "ellipsi": [7, 21], "ellipsis_0": [8, 25, 27, 28], "elmentait": [5, 36], "elmira": 49, "elo": [5, 7, 14, 50], "elosua": 36, "elowitz": 49, "elp": 5, "els": [3, 4, 7, 11, 15, 27, 33, 36, 42, 47], "elsevi": 25, "eltz": 33, "elucid": 14, "elud": 14, "elvira": 3, "em": 23, "email": 30, "emanuel": [17, 26], "emb": [3, 5, 6, 7, 19, 28, 31], "emb_ref_queri": 5, "embed": [3, 4, 5, 6, 8, 10, 13, 15, 16, 19, 21, 26, 28, 31, 36, 44, 45, 50, 51], "embeding_vector": 3, "embopress": [14, 22, 29], "embryo": 49, "embryogenesi": [49, 50], "embryon": [24, 49], "embyrogenesi": 49, "emcj": 1, "emeli": [7, 50, 51], "emerg": [17, 25, 39, 49], "emerton": 2, "emi": 49, "emili": [1, 2, 4, 23, 24, 50], "emit": [18, 24], "emma": [13, 14, 24, 36, 39, 50], "emmanuel": [5, 7, 14, 17, 26, 48, 50], "emp_nul": 13, "emphas": [16, 30], "emphasis": [7, 21], "empir": [7, 14, 15, 16, 27, 28, 32, 33, 41], "emploi": [16, 23, 25, 30, 49], "empti": [1, 11, 21, 25, 34, 47, 48], "emptydrop": 23, "emptydropscellrang": 23, "emptyset": 23, "emr": 23, "emuls": 9, "en": [5, 6, 7, 15, 19, 21, 27, 50], "en_u": [25, 27, 28], "enabl": [2, 3, 5, 6, 7, 9, 11, 13, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 39, 41, 48, 49, 50], "enable_plugin_devic": 5, "enard": [23, 24], "encapsul": [23, 24], "enclos": 18, "encod": [2, 3, 7, 11, 16, 18, 23, 26, 27, 36, 37], "encode_data": 27, "encode_tcr": 3, "encompass": 7, "encount": [11, 13, 17, 21, 23, 36], "encourag": [5, 19, 21, 22, 24, 30, 51], "end": [1, 2, 3, 4, 5, 7, 8, 9, 11, 14, 18, 21, 23, 24, 25, 40, 48, 51], "endo": 16, "endocrin": [13, 25, 51], "endotheli": [5, 36], "enforc": [7, 11, 16, 38], "eng": [24, 37], "engag": [8, 30], "engelbert": [25, 50], "engelhardt": 5, "engelmann": 5, "engin": [21, 49], "england": 14, "enhanc": [6, 8, 23, 25, 26, 30, 37, 38, 49], "enough": [7, 11, 13, 15, 16, 24, 25], "enrich": [2, 4, 8, 13, 17, 23, 25, 26, 40, 47, 48, 49], "enrichr": 15, "ensdb": 10, "ensembl": [15, 23, 26, 34, 36], "ensg00000120705": 23, "ensg00000186092": [19, 36], "ensg00000187642": 36, "ensg00000187961": 7, "ensg00000188290": 36, "ensg00000188976": [7, 36], "ensg00000198695": 7, "ensg00000198727": 7, "ensg00000198786": 7, "ensg00000198961": 23, "ensg00000215611": 19, "ensg00000215616": 19, "ensg00000215635": 19, "ensg00000228794": [7, 36], "ensg00000237491": [7, 36], "ensg00000237613": [19, 36], "ensg00000238009": [19, 36], "ensg00000239945": [19, 36], "ensg00000241860": 7, "ensg00000243485": [19, 36], "ensg00000245526": 23, "ensg00000251180": 19, "ensg00000268590": 19, "ensg00000271254": 7, "ensg00000273748": 7, "ensur": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "entail": [16, 24, 37], "enter": [14, 38, 47, 49], "entero_ix": 13, "enterocyt": 13, "entir": [1, 5, 9, 11, 16, 17, 23, 24, 30, 36, 38, 48, 49, 51], "entireti": [0, 23], "entiti": [24, 25, 36], "entitl": 49, "entpd1": 27, "entri": [2, 4, 5, 7, 11, 23, 27, 38], "entropi": 7, "entrypoint": [1, 7, 15, 25], "enumer": [14, 15, 26, 36, 38], "env": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "environ": [1, 2, 3, 4, 6, 7, 8, 11, 13, 15, 16, 19, 21, 23, 24, 31, 32, 33, 36, 38, 43], "environment": [1, 24], "environment_nam": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "envis": 29, "enzym": [2, 9, 18, 24, 25], "eosinophil": 17, "ep": 51, "epha4": [5, 12], "epigenet": [8, 9, 15, 24], "epigenom": 8, "episcanpi": 8, "epitheli": [5, 13, 15, 50], "epithelium": [13, 22, 49], "epitop": [1, 2, 3, 16, 47, 48, 50], "epn2": 8, "epoch": [5, 7, 16, 27, 28, 36, 37, 38], "epsilon": [36, 51], "epsilon_g": 36, "epstein": 4, "epsti1": 25, "equal": [3, 7, 11, 13, 14, 16, 18, 19, 23, 25, 33, 49], "equat": [17, 48, 51], "equilibria": 51, "equilibrium": 51, "equip": 49, "equival": [7, 19, 23, 26, 27, 28, 31, 50], "er": [5, 7, 23, 50, 51], "eran": [9, 23], "eraslan": 7, "erb": 47, "ercument": 11, "erdogan": 23, "ergen": 36, "ergo": 4, "ergo_input": 4, "erhan": 23, "erhard": 50, "eri": 12, "eric": [4, 15, 16, 36, 39, 41, 50], "erica": [5, 14, 19, 23, 27, 28], "erick": 25, "ericson": [23, 24], "erik": [17, 26, 50, 51], "erji": 15, "erkan": 23, "erl": 23, "eroglu": 11, "erron": [23, 24, 51], "error": [1, 2, 3, 5, 11, 13, 14, 16, 17, 18, 24, 26, 27, 28, 32, 33, 34, 38, 49, 50], "erwin": 24, "ery_1": 50, "ery_2": 50, "eryani": [2, 24], "erythroblast": [5, 7, 12], "erythrocyt": 5, "erythroid": [5, 50, 51], "erythrophagocyt": 5, "es_clon": 49, "esc": 49, "escap": 16, "escherichia": 26, "esen": 13, "eset": 17, "esfahani": 17, "especi": [2, 3, 4, 5, 6, 7, 13, 14, 19, 21, 23, 24, 27, 29, 33, 36, 43, 45, 48, 49, 50], "espeland": 14, "espinosa": 23, "esrra": 41, "essenti": [5, 9, 13, 16, 18, 23, 25, 29, 30, 33, 37, 39, 48], "esser": 51, "est": 34, "establish": [1, 15, 21, 22, 23, 25, 33], "estat": 48, "esteban": 37, "estim": [2, 3, 11, 13, 14, 15, 16, 18, 23, 24, 26, 27, 29, 33, 34, 36, 38, 41, 47, 49, 50, 51], "estimate_balancing_weight": 27, "estimatedisp": 14, "estrada": 48, "et": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 47, 48, 49, 50, 51], "etc": [2, 3, 4, 5, 7, 14, 15, 21, 23, 26, 34], "ete3": 14, "ethen": 9, "ethnic": [7, 27, 28], "etienn": [6, 22], "etil": 7, "etp": 5, "etv6": 5, "eu": 2, "euchromatin": 9, "euclidean": [6, 31, 37], "eui": 1, "eukaryot": [24, 26], "eun": [2, 7, 26], "eunic": [14, 15, 16, 25], "eunjung": 15, "europ": [7, 21], "eval_adata": 16, "evalu": [3, 4, 5, 6, 7, 11, 13, 15, 17, 23, 25, 27, 30, 32, 33, 34, 49], "evaluate_0": 8, "evan": [7, 23, 24, 34, 36, 38], "evas": 16, "evavold": 2, "even": [0, 1, 2, 3, 4, 5, 7, 9, 11, 13, 15, 16, 19, 21, 23, 24, 27, 28, 29, 38, 43, 49, 50, 51], "event": [1, 11, 15, 18, 24, 25, 26, 31, 41, 51], "eventu": [2, 16, 24], "ever": 25, "everi": [1, 2, 4, 5, 7, 9, 11, 13, 14, 15, 16, 22, 24, 25, 26, 30, 38, 41, 49], "everyth": [14, 19, 34], "evgeni": [5, 7, 16, 50], "evgenia": 49, "evgenii": 4, "evgenij": 7, "evid": [1, 3, 4, 8, 16, 19, 23, 26], "evolut": [2, 21, 49], "evolution4": 21, "evolutionari": [24, 49], "evolv": [15, 22, 24, 29, 34], "evqlqqsgpelvkpgasvkisckasgysfnnyymnwvkqspeksl": 4, "evqlqqsgpelvkpgasvkisckasgysftdyymnwvkqspeksl": 4, "evqlqqsgpelvkpgasvkisckasgysftgyymnwvkqspeksl": 4, "evttvt20": 25, "ewa": 14, "ex": 3, "exacerb": 49, "exact": [1, 4, 7, 14, 15, 23, 30, 32, 39, 43, 50], "exactli": [5, 7, 23, 25, 28, 36, 38, 50], "exagger": 7, "examin": [3, 11, 13, 14, 16, 19, 23, 24, 25, 30, 36], "exampl": [1, 2, 3, 4, 5, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 48, 49, 50, 51], "examplatori": 4, "example_data_glob": 13, "example_data_sampl": 13, "exce": [37, 49], "exceed": [34, 48], "excel": 49, "except": [1, 2, 4, 13, 16, 23, 24], "excess": [14, 34], "excis": 23, "excit": 49, "excitatori": 16, "exclam": 23, "exclud": [3, 4, 5, 11, 13, 14, 15, 22, 32, 34, 36], "exclus": [19, 22, 25, 46], "execut": [7, 13, 15, 16, 18, 21, 23, 25, 26, 34], "exemplari": [36, 43], "exercis": 9, "exert": 14, "exhaust": [30, 49, 50], "exhibit": [14, 23, 24, 30, 51], "exist": [2, 3, 4, 5, 7, 8, 13, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 34, 43, 46, 47, 49], "exist_ok": 51, "exogen": 49, "exon": [18, 23, 24, 51], "exp": [3, 37, 40], "expand": [1, 3, 16, 23, 25, 49], "expanded_onli": 1, "expanding_nod": 49, "expans": [3, 4], "expansion_pvalu": 49, "exparc": 24, "expawsh16": 24, "expbhm": 24, "expda": 24, "expdsz": 24, "expect": [1, 3, 4, 5, 6, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 28, 29, 33, 36, 37, 38, 39, 40, 47, 48, 49, 51], "expected_dict": 36, "expected_orient": 23, "expens": [1, 4, 11, 17, 23, 24, 39], "experi": [0, 1, 3, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 27, 28, 30, 32, 33, 34, 36, 47, 48, 49, 51], "experienc": [23, 30], "experiment": [1, 3, 4, 7, 13, 14, 16, 17, 19, 23, 24, 25, 26, 28, 33, 39, 45, 49, 50, 51], "experimentalist": 49, "experimentlist": 21, "expert": [5, 7, 27, 30], "expflu22": 24, "expgch": 24, "exphhs87": 24, "exphtt17": 24, "expir": 2, "expiry_1": 8, "expizj": 24, "expjhyf72": 24, "expjopa16": 24, "expkgn": 24, "expkma": 24, "expkvaharautiok": 24, "explain": [1, 3, 4, 8, 9, 13, 14, 15, 19, 22, 23, 24, 26, 30, 36, 50], "explan": [2, 3, 4, 15, 22, 23, 40, 42], "explanation_text": 42, "explanatori": 1, "explicit": 38, "explicitli": [7, 11, 13, 14, 19, 23, 27, 33], "explmbw20": 24, "explmph18": 24, "exploit": 1, "explor": [1, 3, 5, 8, 9, 13, 14, 21, 22, 26, 30, 33, 44], "exploratori": [8, 14, 19, 24], "explore_3": [25, 28], "expm1": 3, "expmb": 24, "expmlm": 24, "exponenti": 49, "export": [3, 8, 23, 32, 36], "export_posterior": 36, "exportclass": 21, "expos": 23, "exposur": 4, "exppwt": 24, "expr": [7, 11, 15], "expr_prod": 25, "expr_prop": 25, "express": [2, 3, 6, 7, 8, 9, 13, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 39, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "expressed_gen": 25, "expressed_ligand": 25, "expressed_receptor": 25, "expression_level": 38, "expression_mtx_fnam": 26, "expressionset": 17, "expsaec": 24, "expsnl": 24, "exptyg": 24, "expwhz": 24, "expzll": 24, "expztb": 24, "expzvp": 24, "ext": 27, "extend": [3, 5, 13, 19, 22, 23, 27, 29, 36, 37, 49], "extend_txom": 23, "extens": [2, 3, 5, 7, 11, 13, 16, 17, 19, 21, 22, 23, 24, 25, 30, 33, 36, 49, 51], "extent": [5, 7, 13, 19], "extern": [1, 16, 23, 25, 26, 28, 30, 49], "extra": [2, 7, 25, 34], "extra_chain": 2, "extract": [1, 2, 3, 4, 8, 9, 10, 11, 15, 16, 17, 19, 21, 23, 24, 25, 28, 36, 37, 41, 49, 51], "extract_edge_weight": 1, "extrapol": 16, "extrem": [5, 11, 19, 49, 50, 51], "ey": 49, "eyal": 36, "eytan": 51, "f": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "f0t1h": 23, "f1000research": [2, 5, 6, 7, 11, 14, 15], "f811": 27, "f_j": 38, "fa": [23, 27], "fabian": [2, 3, 5, 6, 7, 9, 11, 14, 16, 17, 19, 22, 23, 25, 27, 28, 29, 30, 34, 36, 37, 40, 41, 48, 50, 51], "fabiana": 8, "fabio": [2, 24], "fac": [2, 5, 13, 17, 24], "face": [30, 38], "facecolor": [6, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "facetgrid": [13, 48], "facil": [7, 24], "facilit": [1, 16, 19, 23, 49], "fact": [1, 7, 13, 15, 16, 18, 23, 24, 25, 31, 38, 47, 48, 51], "factor": [4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 33, 49], "factor_nam": 36, "factor_names_": 36, "factoris": 36, "fail": [1, 5, 13, 14, 16, 17, 23, 27, 28, 48, 50, 51], "failur": [5, 16, 18, 23, 51], "fairli": 25, "faith": 16, "faithfulli": 51, "faiz": 5, "falai": [36, 38], "falco": 23, "falk": [5, 7, 50], "fall": [1, 5, 13, 16, 23, 26, 27, 28, 36, 38, 39, 48], "fals": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 49, 51], "fam138a": [19, 36], "famili": [7, 8, 13, 14, 21, 23], "familiar": [13, 15, 21, 30], "famou": [16, 49], "fan": [5, 7, 15, 23, 44, 50, 51], "fanci": [19, 29], "fanelli": 38, "fang": [9, 26, 36, 38, 49], "fangm": 9, "fanni": 7, "fansi": [7, 21], "fansi_1": [8, 25, 27, 28], "far": [1, 5, 11, 23, 24, 32, 40, 46, 51], "faraz": 23, "farber": 5, "fardeep": 17, "farouni": 23, "farrar": 23, "farrel": 7, "farver_2": [8, 27], "fashion": [3, 34, 36], "fasouli": 5, "fast": [5, 6, 7, 15, 16, 19, 23, 24, 29, 33, 34, 39, 41, 44, 49], "fasta": 23, "fastdummies_1": 27, "fasten": 1, "faster": [1, 5, 8, 11, 13, 15, 16, 18, 23, 38, 49], "fastest": 7, "fastjsonschema": 21, "fastmap": [7, 21], "fastmap_1": [8, 25, 27, 28], "fastmnn": 7, "fastq": [18, 23], "fastq_dir": 23, "fastqc": 23, "fate": [3, 48, 49, 50, 51], "fatemeh": [14, 23], "fault": 16, "faust": 17, "favor": [14, 23, 24], "favour": [7, 33], "faw": 3, "fb": 49, "fbxo31": 41, "fc": [2, 14], "fcer1a": [5, 12], "fcer1g": [5, 12], "fcer2": 27, "fceria": 12, "fcgr3a": [5, 12, 15, 16, 25, 27], "fcgr3a_monocyt": 14, "fcn1": [5, 12], "fcrl1": [5, 12], "fct": 10, "fd": 26, "fdim": 49, "fdr": [13, 14, 15], "fdrtool_1": 25, "fearghal": 51, "feasibl": 4, "feat": 27, "feather": 26, "feather_0": 8, "featur": [1, 3, 4, 5, 10, 13, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 39, 41, 45, 47, 48, 49, 50], "feature_biotyp": 36, "feature_id": 36, "feature_is_filt": 36, "feature_nam": [13, 36], "feature_refer": 36, "feature_typ": [7, 10, 11, 19, 21, 26, 27, 28, 34, 36, 37, 43, 44, 45, 46, 47, 48], "featureplot": 10, "feb": [13, 14, 17, 19, 21, 22, 24, 25, 30, 37, 40, 41, 48], "februari": [5, 7, 9, 23, 24, 36, 41], "fed": 27, "federico": 22, "fedrigo": 24, "feedback": [30, 42], "feedbackid": 42, "feel": [5, 11, 16, 30, 38], "feet": 24, "fei": [15, 16, 36, 37], "feiyang": 17, "fel81": 49, "felicia": 48, "felix": [3, 4, 14, 17, 23, 26], "felsenstein": 49, "femal": 2, "feng": [24, 26, 37, 39, 41, 49], "fengcui": 26, "fennel": 24, "ferguson": [2, 24], "fernand": [13, 48, 50], "fernandez": 27, "fernando": [1, 2, 49], "fern\u00e1ndez": 36, "ferri": 23, "fertil": [1, 49], "fetal": [38, 50], "fetch": [11, 16, 19, 23], "few": [1, 5, 7, 11, 13, 14, 15, 16, 19, 21, 23, 26, 28, 31, 34, 36, 37, 38, 39, 41, 43, 44, 49, 50, 51], "fewer": [6, 7, 14, 34, 37, 49], "fgene": [13, 23, 31], "fgsae": 15, "fgsea": 15, "fhl2": 15, "fibroblast": [5, 14, 36], "ficht": 49, "field": [0, 2, 5, 7, 8, 14, 15, 17, 22, 24, 25, 29, 30, 37, 38, 49, 50, 51], "fieldwork": 24, "fier": 24, "fifth": [7, 11, 27, 28, 34, 48, 50], "fig": [4, 5, 7, 11, 13, 14, 23, 25, 26, 33, 36, 38, 49], "fig_kw": [1, 3], "fight": [2, 5], "figr": 11, "figr_0": 8, "figshar": [2, 3, 5, 7, 11, 15, 25, 31, 32, 33, 34, 36, 38, 43, 44, 45, 46, 47, 48], "figsiz": [1, 3, 4, 5, 11, 13, 15, 16, 25, 26, 33, 36, 37, 38, 40, 49], "figuera": 13, "figueroa": 16, "figur": [4, 5, 9, 11, 13, 16, 23, 25, 36, 49], "figure_s": 25, "filament": 24, "filbi": 50, "file": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "file102cfa97cc51": 21, "file_path": 51, "fileext": 21, "filelock_1": 8, "filenam": [2, 3, 5, 19, 23, 31, 32, 33, 34, 36, 38, 48], "fill": [4, 11, 19], "fillna": 4, "film": 2, "filt": 8, "filter": [3, 4, 5, 7, 8, 14, 16, 17, 18, 19, 23, 24, 25, 33, 36, 37, 38, 46, 47, 48, 50, 51], "filter_and_norm": 51, "filter_cel": [14, 19, 25, 48], "filter_gen": [7, 14, 19, 25, 34, 36, 37, 50], "filter_intbcs_final_lineag": 49, "filter_lambda": 25, "filter_ob": [11, 19], "filter_rank_genes_group": 5, "filter_var": [11, 19, 45], "filterbi": 25, "filterbyexpr": [14, 15], "filtered_contig_annot": 2, "filtered_contig_annotations_csvfil": 3, "filtered_feature_bc_matrix": [11, 19, 34], "filterwarn": [1, 2, 3, 4, 5, 13, 14, 15, 16, 26, 27, 28, 47], "finak": 14, "final": [1, 2, 3, 4, 5, 6, 7, 9, 10, 13, 14, 15, 16, 17, 19, 23, 24, 25, 27, 28, 30, 34, 36, 40, 48, 49, 50], "find": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 21, 23, 24, 27, 28, 33, 36, 37, 40, 41, 43, 49, 50], "find_de_mast_r": 14, "find_hotspot_featur": 3, "find_pandoc": 8, "findbridgetransferanchor": 27, "findintegrationanchor": [7, 28], "findlai": 49, "findmultimodalneighbor": 28, "findtransferanchor": 27, "findvariablefeatur": 7, "fine": [5, 7, 16, 26, 27, 36, 43, 50], "finer": [5, 6, 7], "fingerprint": 16, "finish": [3, 5, 8, 28, 36, 37, 38, 40, 41, 50, 51], "finotello": [2, 13, 19], "fiona": [6, 15, 50], "fior": [3, 4], "first": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 25, 27, 28, 29, 31, 33, 34, 36, 37, 38, 40, 41, 43, 47, 48, 49, 50, 51], "firstli": [6, 21, 34], "fischer": [3, 7, 9, 19, 24, 25, 28, 29, 37, 40, 41], "fish": 38, "fisher": 15, "fishpond": 23, "fiskin": 7, "fit": [5, 7, 11, 14, 16, 19, 23, 24, 25, 27, 28, 32, 38, 48, 49, 51], "fit_alpha": 51, "fit_beta": 51, "fit_gamma": 51, "fit_likelihood": 51, "fit_model": 14, "fit_par": 51, "fit_reg": 14, "fit_scglu": 27, "fit_transform": 19, "fitargsd": 14, "fitch": 49, "fitdistrplu": [7, 21], "fitdistrplus_1": [8, 25, 27, 28], "five": [1, 7, 16, 51], "fix": [1, 4, 13, 14, 15, 18, 21, 27, 28, 33, 36], "fix_dtyp": 14, "fixedformatt": 1, "fixedloc": 1, "flag": [2, 5, 14, 23, 26, 46], "flanagan": 5, "flank": [9, 11], "flat": 21, "flatten": [26, 47], "flavel": 13, "flavor": [7, 15, 17, 21, 26], "flavour": 36, "flax": 7, "fle": 15, "fleme": [5, 14, 19, 27, 28], "fleri": 4, "fletcher": 50, "flex": 42, "flexibl": [4, 7, 14, 15, 21, 23, 24, 30], "flh": 49, "flip": 42, "flip_card": 42, "flkekggl": 4, "float": [1, 4, 14, 17], "float32": [5, 7, 11, 13, 19, 21], "float64": [7, 11, 16, 17, 21, 26], "float_0": 8, "flongl": 24, "flora": 49, "flore": [15, 25, 36], "florenc": 49, "florescu": [14, 49], "florian": [2, 3, 4, 13, 15, 17, 19, 22, 26, 29, 36, 47, 48, 50], "flow": [1, 2, 6, 24, 30, 48], "flowcel": [18, 23], "floyd": 24, "flt4": 38, "fluctuat": 23, "fluoresc": [2, 18, 24, 38, 49], "fmicb": 13, "fname": [44, 45, 46, 47, 48], "fndc3b": [5, 12], "fnn": 8, "fnn_1": 8, "fo": [7, 12], "focu": [3, 4, 5, 6, 7, 9, 14, 15, 19, 21, 23, 25, 38, 46, 48, 49], "focus": [1, 3, 4, 7, 17, 19, 21, 22, 23, 25, 32, 49], "fold": [13, 14, 15, 23, 25, 51], "folder": [3, 19, 21, 23, 49], "follicular": 5, "follow": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "fong": [23, 24], "font": [8, 42], "font_famili": 8, "fontconfig": [14, 27], "fontfamili": 8, "fontsiz": [7, 8], "fonttool": [1, 25], "foo": [19, 40], "footprint": [10, 15, 25], "foral": 36, "forc": [7, 13, 23, 24, 26], "force_upd": 5, "foreach_1": [8, 25], "forecast": 16, "foreground": 28, "foreign": [1, 2], "foreign_0": 25, "foremost": [13, 49], "forest": 16, "forg": [1, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "forget": 0, "fork": 13, "form": [2, 3, 4, 6, 9, 13, 14, 16, 19, 24, 25, 26, 28, 32, 33, 34, 36, 37, 41, 44, 49, 50, 51], "formal": [30, 38], "format": [1, 3, 4, 7, 8, 13, 15, 16, 18, 19, 23, 24, 25, 26, 34, 49], "format_contrast_result": 25, "former": [23, 24, 32], "formerli": 4, "formul": [36, 37, 51], "formula": [13, 14, 33], "formula_1": 25, "forouzmand": 49, "forrest": 25, "forrow": 49, "forth": [5, 49], "fortun": 49, "forum": [11, 27, 28, 34, 48], "forward": 23, "foster": 16, "fotaki": [2, 13, 19], "foti": 23, "found": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 27, 28, 30, 34, 36, 37, 38, 49, 50, 51], "foundat": [19, 21, 22, 23, 30], "four": [1, 4, 13, 16, 23, 28, 34, 36, 38, 48, 49, 51], "fourth": [1, 49], "fov": 38, "foxp3": 12, "fp": 25, "fpd": 4, "fpr": 21, "fpr1": [8, 12], "fqdn": 21, "fr": 36, "frac": [23, 33, 38, 40, 41, 48, 51], "frac_atac": 8, "fraction": [1, 2, 4, 5, 11, 13, 17, 19, 23, 32, 34, 49], "frag_path": 11, "fragmen_fil": 10, "fragment": [2, 9, 10, 18, 19, 23, 24, 28], "fragment_fil": 10, "fragment_histogram": 11, "frame": [2, 7, 8, 10, 11, 14, 15, 17, 19, 21, 24, 25, 28, 34], "frameon": [1, 5, 6, 15, 16, 25, 27, 28, 31, 32, 33, 34, 38, 43, 44, 45, 46, 47, 48, 51], "framework": [0, 4, 9, 13, 14, 15, 17, 21, 22, 23, 25, 27, 28, 32, 33, 34, 37, 40, 41, 48, 49, 50, 51], "fran": 8, "franc": 42, "franca": 36, "francesca": [2, 13, 19], "franci": 40, "francisco": 24, "francoi": 1, "frangieh": 16, "frank": [23, 24], "franklin": 24, "franz": 15, "fraticelli": 49, "fred": 24, "frederick": [24, 49], "fredrik": 49, "free": [11, 13, 16, 19, 23, 25, 30, 34, 50], "freeze_dropout": 5, "freq": [14, 49], "frequenc": [1, 3, 4, 13, 16, 23, 24, 49], "frequent": [4, 16, 19, 23, 24], "frequentist": 13, "fresh": 24, "freytag": 6, "frieda": 49, "friedel": 50, "friedman": [1, 4], "friedrich": 24, "friendli": [19, 22], "frishberg": 17, "from": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 50, 51], "from_dict": 49, "from_iter": 15, "from_record": 15, "from_scirpi": 1, "from_scvi_model": 7, "front": [13, 42], "front_color": 42, "front_font_s": 42, "frontier": [1, 2, 4, 13, 23, 31], "frontiersin": [13, 31], "frozen": 24, "frugal": [23, 51], "fry": 51, "fry_result": 15, "fry_results_negative_ctrl": 15, "fs21": 49, "fsgsr20": 32, "fsspec": [1, 7], "fsthai19": 32, "fsv": 41, "fth1": [14, 16, 36], "ftl": 14, "ftlnnstedt": 6, "fu": [5, 37], "fuent": 40, "fuert": 24, "fufa": 7, "fujiwara": 5, "fulfil": [1, 13], "full": [2, 3, 4, 5, 8, 11, 13, 14, 19, 24, 26, 27, 28, 29, 30, 36, 41, 47, 48, 49, 50, 51], "full_clust": 3, "full_combin": 1, "full_data": 27, "full_length": 2, "fullam": 49, "fulli": [5, 7, 16, 19, 24], "fullinmemori": 11, "fun": [15, 19], "function": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 47, 49, 50, 51], "function_bas": 17, "functool": [21, 25], "fundament": [0, 16, 18, 19, 22, 23, 24, 25, 30, 49], "funstion": 11, "fuqua": 49, "furchtgott": 49, "furlan": [50, 51], "furlong": 8, "further": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 16, 19, 21, 23, 24, 25, 26, 29, 30, 31, 34, 38, 44, 48, 49], "furthermor": [1, 5, 7, 9, 10, 11, 13, 15, 22, 25, 29, 48], "fuse": 3, "fusion": 24, "futil": 26, "futur": [3, 4, 7, 11, 15, 18, 19, 21, 25, 27, 28, 49, 50, 51], "future_1": [25, 27, 28], "future_fstr": 1, "futurewarn": [1, 2, 3, 4, 7, 11, 15, 19], "fuxiang": 37, "fw": 23, "fxyd1": 15, "fxyd7": 15, "g": [1, 2, 3, 4, 5, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 30, 32, 33, 36, 38, 39, 41, 46, 48, 49, 50, 51], "g2m": 16, "g2m_score": 51, "g_": 38, "g_elbo": 27, "g_kl": 27, "g_nll": 27, "gaatcaccacggaagt": 27, "gabitto": [7, 28], "gabriel": [7, 13, 38], "gabriela": 15, "gaccaatcaatttcgg": [27, 28], "gadala": 1, "gag": 24, "gage": 24, "gagga": 49, "gagneur": [9, 28], "gagnon": 49, "gagttgtcagtcggaa": 28, "gai": [5, 7, 50], "gain": [1, 13, 16, 30, 49], "galagan": 26, "galaxi": 23, "galen": 7, "galm": 25, "gama": 26, "gamerith": 13, "gamma": [3, 5, 36], "gamma_g": 51, "gan": 15, "ganz": 49, "gao": [15, 23, 25, 26, 27, 49, 51], "gaom": 15, "gap": [2, 4, 19, 23, 25, 48], "gapml": 49, "garbag": 16, "garcia": [11, 15, 25, 26], "gardeux": 50, "gari": [1, 2, 50], "garnett": [5, 15], "garren": 24, "garrett": [13, 22], "garri": 4, "garrido": 25, "garritano": 25, "garsk": 23, "gartland": [3, 4], "gartner": [11, 23], "gastro": 40, "gastroenterologi": 40, "gastrul": 5, "gata1": 12, "gata2": [12, 17], "gata3": 8, "gatat": 49, "gatataattc": 49, "gatatccgaa": 49, "gatekeep": 43, "gather": [17, 24], "gatto": [19, 22], "gaujoux": 17, "gaussian": [16, 28, 31, 41], "gautier": [14, 16], "gave": [1, 49], "gayoso": [5, 7, 9, 27, 28, 36, 50, 51], "gb": [13, 24], "gbh": 49, "gc": [23, 24, 33], "gca": [26, 49], "gcaggctgttgcatac": 27, "gcattagcataagcgg": [27, 28], "gcc": [1, 25], "gccatgatcccttgcg": 7, "gcctacttaagtccr1": 49, "gcgga": 49, "gcggaaagtacgcgtc": 27, "gctacaacagtgcgct": 28, "gctgggtgtacggatg": 27, "gdk": 49, "gdo": 16, "gdt": [1, 2, 12], "ge": [23, 24, 27], "geffer": [17, 26], "gehr": [23, 51], "geiger": 16, "geiss": 15, "geistling": [21, 22], "gel": 9, "gelfand": 40, "gem": 9, "gen_loss": 27, "gencod": 23, "gender": [2, 14, 15], "gene": [2, 3, 4, 6, 9, 10, 11, 13, 17, 18, 19, 21, 23, 24, 27, 28, 30, 31, 32, 33, 34, 39, 40, 43, 44, 48, 49, 50, 51], "gene_": [19, 21], "gene_0": [19, 21], "gene_1": [19, 21], "gene_1990": 19, "gene_1991": 19, "gene_1992": 19, "gene_1993": 19, "gene_1994": 19, "gene_1995": 19, "gene_1996": 19, "gene_1997": 19, "gene_1998": [19, 21], "gene_1999": [19, 21], "gene_2": 19, "gene_3": 19, "gene_4": 19, "gene_5": 19, "gene_6": 19, "gene_7": 19, "gene_8": 19, "gene_9": 19, "gene_act": 10, "gene_activity_": 10, "gene_annotation_gtf": 23, "gene_bas": 26, "gene_id": [5, 7, 10, 11, 19, 21, 27, 28, 34, 36, 37, 43, 44, 45, 46, 47, 48], "gene_likelihood": 7, "gene_list": 16, "gene_nam": [5, 11], "gene_stuff": 19, "gene_symbol": [14, 26], "gene_target": 16, "gene_to_lowercas": 38, "geneactivity_": 10, "genelist": 8, "gener": [1, 2, 3, 4, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 41, 43, 44, 45, 48, 49, 50], "generaliz": 5, "generalmatrix": 10, "generate_network": 1, "generate_sample_level": 13, "generics_0": [8, 25, 27, 28], "genes2filt": 46, "genes_vs_motif": 26, "geneset": [14, 15, 25], "geneset_oi": 25, "geneset_s": 15, "genesi": 49, "genesymbol": 15, "genet": [1, 2, 8, 9, 13, 14, 15, 16, 18, 23, 24, 25, 30, 31, 39, 49], "geneviev": 51, "gennadi": [15, 23], "gennert": 7, "genom": [2, 3, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 22, 24, 25, 26, 27, 28, 30, 32, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50, 51], "genome_fasta": 23, "genome_fil": 23, "genomebiologi": 11, "genomeinfodb": [7, 21], "genomeinfodb_1": [8, 15, 27, 28], "genomeinfodbdata": [7, 21], "genomeinfodbdata_1": [8, 15, 27, 28], "genomicalignments_1": 8, "genomicrang": [7, 11, 21], "genomicranges_1": [8, 15, 27, 28], "genotyp": [16, 24], "gentil": 50, "gentl": 17, "gentleman": [19, 22], "geoff": [23, 24], "geoffrei": 49, "geol": 13, "geom": [7, 21], "geom_3": [25, 27, 28], "geom_label_repel": 8, "geom_point": 8, "geom_point_rast": 8, "geom_seg": 10, "geom_text_repel": 8, "geometr": [5, 13, 25, 47], "georg": [3, 4, 11, 13, 17, 26, 37, 49], "georgio": [2, 13, 19], "gephart": 24, "gerald": 49, "gereon": [17, 26], "germain": [11, 32, 33, 34], "germani": 42, "germin": 5, "germlin": 1, "germline_align": 1, "gerold": 13, "gerrit": 49, "gerstein": 51, "gerstung": [36, 49], "gersuk": 14, "gert": [8, 9, 15, 23, 26], "gertruda": 51, "gesmira": 27, "get": [1, 2, 3, 5, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 24, 25, 26, 27, 29, 30, 33, 34, 37, 38, 39, 41, 42, 50], "get_attribut": 49, "get_cmap": 7, "get_contrast": 25, "get_convers": 28, "get_expressed_gen": 25, "get_gene_annotation_from_rna": 19, "get_lat": 3, "get_latent_represent": [5, 7, 13, 16, 27, 28], "get_legend": 38, "get_plugin_device_cli": 5, "get_pseudobulk": 25, "get_resourc": 15, "get_vers": [1, 15, 25], "get_weighted_ligand_target_link": 25, "get_ylim": 26, "getassaydata": [7, 21], "getattr": [11, 36], "getdorcscor": 8, "getelementbyid": 42, "getgrangesfromensdb": 10, "getnnz": 25, "getoptlong_1": [8, 25], "geurt": [15, 26], "gex": [7, 26, 48], "gex_data": 3, "gex_data_typ": 3, "gex_n_count": [7, 27, 28], "gex_n_gen": [7, 27, 28], "gex_n_genes_by_count": [27, 28], "gex_pct_counts_mt": [7, 27, 28], "gex_phas": [7, 27, 28], "gex_pseudotime_ord": [7, 27, 28], "gex_size_factor": [7, 27, 28], "gex_x_pca": [7, 27, 28], "gex_x_umap": [7, 8, 26, 27, 28], "ggaatg": 49, "ggaca": 49, "ggaccgaagtgaggta": 7, "ggbeeswarm_0": 8, "ggcgga": 49, "gggcactaggatgtat": 3, "ggh": 49, "ggplot": [8, 25], "ggplot2": [7, 8, 21, 25], "ggplot2_3": [8, 25, 27, 28], "ggpubr": 25, "ggrastr": [8, 11], "ggrastr_1": 8, "ggrepel": [7, 8, 21], "ggrepel_0": [8, 25, 27, 28], "ggridg": [7, 21], "ggridges_0": [25, 27, 28], "ggtitl": 8, "ghamdan": [2, 24], "ghazanfar": [7, 51], "ghn": [3, 4], "ghrl": 51, "giaa151": [23, 34], "giab061": 7, "giac001": 23, "giacomo": [14, 25], "giang": [2, 24], "gianni": 17, "giansanti": 13, "giant": 0, "gideon": [36, 51], "gieli": 2, "giga": 24, "gigant": 13, "gigasci": [7, 23, 34], "gil": 7, "gilbert": 1, "gillen": 5, "gillespi": 49, "gillett": [5, 15], "gillich": 7, "gilliland": 5, "gimvi": 38, "gingera": 23, "gioel": [14, 16, 23, 24, 50, 51], "giotti": 7, "giotto": 37, "giovanni": [5, 19, 25, 37, 40, 41], "giraldez": 13, "girk": [19, 22], "girski": 49, "git": [13, 49], "github": [3, 4, 5, 7, 8, 21, 23, 25, 27, 28, 30, 33, 49], "githubusercont": [8, 26], "gitlab": 1, "gittelman": 4, "giulia": 25, "give": [5, 7, 11, 13, 34, 38, 40, 48, 49, 50], "given": [1, 7, 8, 9, 11, 13, 14, 15, 16, 23, 25, 26, 27, 34, 36, 37, 38, 49, 50, 51], "giy059": 23, "gjl": 49, "gkaa740": 38, "gkab004": 7, "gkab043": 36, "gkv007": 14, "gkz204": 25, "gkz562": 9, "gl": [17, 26], "gl000009": 11, "gl000194": 11, "gl000195": 11, "gl000205": 11, "gl000213": 11, "gl000218": 11, "gl000219": 11, "glahn": 13, "glanc": 16, "glanvil": [3, 4], "glass": 18, "glean": 49, "gleb": 7, "gleixner": 15, "glenn": 2, "glib": 13, "glibc2": [1, 25], "glioblastoma": 49, "gliph": 3, "glm": [13, 14], "glmer": 14, "glmgampoi": [31, 32, 33, 34], "glmmtmb": 14, "glmpca": [31, 32, 33, 34], "glmqlfit": 14, "glmqlftest": 14, "glmtreat": 14, "glob": 26, "glob2": [43, 44, 45, 46, 47, 48], "global": [7, 8, 10, 13, 15, 16, 17, 19, 21, 23, 27, 28, 31, 36, 50], "globalenv": [21, 32, 33], "globaloptions_0": [8, 25], "globals_0": [25, 27, 28], "globin": 24, "gloor": 13, "gloria": [2, 5, 43], "glossari": 30, "glue": [7, 21], "glue_1": [8, 25, 27, 28], "gluetmpe8ok569r": 27, "gluetmpx6ds9f5b": 27, "glutam": 24, "glutamaterg": 24, "gm2a": 8, "gmap": 7, "gmean_pval": 25, "gmp": 5, "gmp_0": 8, "gmpr": 14, "gmt": 15, "gmt_to_decoupl": 15, "gn35bga1rt": [11, 27, 28, 34, 48], "gnaq": 5, "gnaz": 38, "gnirk": 24, "gnly": [5, 12], "gnotificationcenterdeleg": 13, "gnu": [8, 25, 27, 28], "gnuplot2": 50, "go": [5, 8, 13, 15, 23, 24, 25, 34, 38, 44, 46, 50], "goal": [7, 16, 34, 49, 50], "goblet": 13, "goe": 19, "goeman": 15, "goettgen": 51, "goeva": 36, "goff": 51, "goffinet": [17, 26], "goftest": [7, 21], "goftest_1": [25, 27, 28], "goh": [7, 50], "goir": [14, 16], "golani": 36, "gold": [23, 26], "goldi": 24, "goldman": [23, 24], "golub": [5, 15], "gome": [5, 23], "gon": [50, 51], "gonad": 25, "gone": 21, "gong": 49, "gonz": [8, 15, 26], "gonzal": 50, "gonzalez": 49, "gonz\u00e1lez": 9, "good": [2, 5, 7, 11, 13, 16, 17, 23, 24, 25, 29, 34, 36, 38, 40, 47, 49], "goodnow": 24, "googl": [1, 5, 7, 31, 40], "gordon": [14, 15, 19, 22], "gorfin": 15, "gorin": 23, "got": [7, 11, 19], "gote": 5, "gottardo": [5, 14, 19, 22, 27, 28, 37, 47, 48], "gould": [7, 49], "gov": 14, "govek": 50, "govern": [49, 51], "govinda": 5, "gower_1": 25, "gp": 8, "gpar": 8, "gpb": 24, "gpl_out_dir": 23, "gplot": [8, 11], "gplots_3": 8, "gpr153": 7, "gpu": [3, 5, 7, 16, 27, 28, 36, 38], "gpu_mod": 28, "gpuallocatorconfig": 5, "gr": [14, 16, 23, 24, 31, 37, 40, 41, 50], "grace": [13, 22, 23, 24], "grade": 26, "gradient": [7, 23, 25, 31, 50], "gradual": 23, "graham": 7, "grain": [16, 36, 43, 50], "granado": [7, 11, 27, 28, 34, 48, 49], "grand": [9, 14], "granda": 27, "grang": 11, "granja": [3, 9], "grant": 7, "granulocyt": 5, "graph": [1, 3, 4, 5, 6, 8, 13, 16, 18, 19, 23, 26, 28, 31, 33, 34, 36, 40, 41, 45, 50, 51], "graph_1": 8, "graph_batch_s": 27, "graph_conn": [7, 28], "graph_conn_": 28, "graph_label": 3, "graph_vs_featur": 3, "graph_vs_graph": 3, "graph_vs_graph_stat": 3, "graphic": [1, 8, 15, 25, 27, 28], "grasp": [30, 45], "grasshoff": [17, 26], "grate": 0, "gratefulli": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48, 49, 50], "gravelin": 49, "graybuck": 24, "grch38": [23, 36], "grdevic": [8, 15, 25, 27, 28], "greanei": 25, "great": [2, 3, 4, 16, 19, 25, 29, 49], "greater": [2, 7, 21, 22, 33], "greatli": [4, 13, 49], "greedi": [23, 49], "greedili": 23, "greedy_solv": 49, "greedysolv": 49, "green": [7, 23], "greenbaum": 4, "greenleaf": [8, 9, 50], "greg": 14, "gregor": [2, 13, 19, 25], "gregori": [2, 5, 13, 23, 24, 49], "grei": [5, 13], "grepl": 8, "grice": 37, "grid": [8, 37, 39, 40, 41], "grid_4": [15, 25, 27, 28], "gridextra": [7, 21], "gridextra_2": [25, 27, 28], "gridion": 24, "griffant": 43, "grik4": [5, 12], "grime": 23, "grindberg": 24, "grn": 8, "grna": 16, "grnagonzalezbm": 26, "grnboost": 26, "grnfsl": 26, "grngahi": 26, "grnhss": 26, "grnssrp": 26, "grnszsanchezperez": 26, "groblewski": 24, "grosswendt": 49, "grott": 49, "ground": [13, 16, 25, 30, 33, 49], "group": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 15, 16, 17, 18, 19, 24, 25, 26, 27, 28, 33, 36, 37, 39, 41, 43, 48, 49], "group1": 13, "group2": 13, "group_abund": [1, 2], "group_col": [3, 25], "group_field": 1, "group_kei": 14, "group_nam": 14, "group_per_sampl": 17, "group_shuffle_split": 3, "groupbi": [1, 2, 3, 5, 11, 14, 15, 16, 25, 26, 43, 46, 49, 50], "groupctrl": 14, "groupctrl_b_cel": 15, "groupctrl_cd14__monocyt": 15, "groupctrl_cd4_t_cel": 15, "groupctrl_cd8_t_cel": 15, "groupctrl_dendritic_cel": 15, "groupctrl_fcgr3a__monocyt": 15, "groupctrl_nk_cel": 15, "grouper": 11, "grouping_vari": 49, "groups_col": 25, "groups_label": 28, "groupstim": 14, "groupstim_b_cel": 15, "groupstim_cd14__monocyt": 15, "groupstim_cd4_t_cel": 15, "groupstim_cd8_t_cel": 15, "groupstim_dendritic_cel": 15, "groupstim_fcgr3a__monocyt": 15, "groupstim_nk_cel": 15, "grow": [7, 23, 24, 25, 29, 34, 49], "growth": [13, 16, 49], "gruhn": 25, "grunkvo14": 31, "gsea_geneset": 15, "gsea_result": 15, "gseabase_1": 8, "gsl": [27, 28], "gspaagonzalezbm": 15, "gspabimvelezsb": 15, "gspactk": 15, "gspadg04": 15, "gspadj": 15, "gspafranzengbjorkegren19": 15, "gspafsl": 15, "gspagahi": 15, "gspagbuhlmann07": 15, "gspahanzelmanncg13": 15, "gspahs19": 15, "gspahtppaton": 15, "gspaksb": 15, "gspakst": 15, "gspalc": 15, "gspalck": 15, "gspalmm16": 15, "gspalsp": 15, "gsparpw": 15, "gspaskklunemann": 15, "gspasmy05": 15, "gspastm": 15, "gspazlx": 15, "gspazmh": 15, "gsub": [15, 21], "gsva": 15, "gt": [10, 14], "gtaaccatcggagtga": 28, "gtabl": [7, 21], "gtable_0": [8, 25, 27, 28], "gtagaaagtgacacag": [27, 28], "gtcaagtcaaggactg": 3, "gtcgtaatcaccgtaa": 3, "gtf": 23, "gtf_file": 23, "gtg": 24, "gtgcagcgtctcccta": 3, "gtggttagtcgagttt": 28, "gtools_3": 8, "gttgtggcccaacatggcagcgtgccgtagcttagttgtcaggccatttgctgg": 49, "gtttatttccgtatr3": 49, "gu": [37, 51], "guangyao": 37, "guanin": 18, "guarante": [5, 6, 19, 23, 26, 50], "guenthoer": 37, "guerrero": 25, "guess": 5, "gui": [2, 13, 16], "guibentif": 51, "guid": [0, 3, 7, 8, 9, 14, 16, 22, 23, 24, 26, 27, 28, 30, 34, 48, 49], "guide_id": 16, "guide_legend": 8, "guide_rna_column": 16, "guidebook": 39, "guidelin": [4, 7, 22, 24, 49], "guilin": [7, 11, 27, 28, 34, 48], "guillaum": [6, 50], "guillaumet": 24, "guinnei": 15, "guion": 3, "gummert": 36, "guna": 16, "gunilla": 1, "gunzip": 23, "guo": [4, 5, 7, 36, 37, 38, 49, 50, 51], "guohao": 49, "gupta": [1, 23, 24], "gur": 1, "guryev": 14, "gus91": 49, "gusfield": 49, "gut": [24, 36], "gutierrez": [5, 7, 50], "guttorp": 40, "gvhu": 1, "gwendolyn": 15, "gypa": [5, 12], "gz": [10, 11, 19, 23, 49], "gzip": 19, "gzma": [5, 12], "gzmb": [5, 12], "gzmh": [5, 12], "gzmk": [5, 12], "g\u00f6ttgen": 6, "h": [1, 3, 5, 7, 13, 14, 15, 16, 17, 22, 23, 24, 25, 26, 36, 37, 43, 49, 50], "h2": 25, "h5": [3, 10, 11, 19, 34, 48], "h5ad": [1, 2, 3, 4, 5, 6, 7, 10, 11, 15, 17, 18, 19, 25, 26, 27, 28, 31, 32, 33, 34, 36, 38, 43, 49, 50, 51], "h5ad_fil": 21, "h5group": 21, "h5l": 19, "h5mu": [10, 19, 21, 44, 45, 46, 47, 48], "h5py": [1, 7, 15, 21, 25], "h5seurat": 21, "h5seurat_fil": 21, "ha": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, 36, 37, 38, 41, 48, 49, 51], "haan": 49, "haas": 24, "haber": [7, 13, 22], "haber_2017_region": 13, "habermann": 7, "hach": 23, "hacohen": 24, "had": [7, 10, 15, 16, 49], "hada": 36, "haegeman": 24, "hafemeist": [7, 15, 16, 47, 48, 50], "hafler": 1, "hagemann": 23, "hagen": 24, "haghverdi": [7, 50, 51], "hagood": 5, "hahn": [19, 22], "hai": [13, 22], "haider": [2, 19], "haig": 23, "hailiang": 5, "haitao": 37, "haiyan": 25, "haiyang": 48, "hajim": 23, "halder": 36, "half": [19, 37, 49, 51], "hall": 40, "hallmark": 15, "halperin": 23, "haltal": 50, "ham": [18, 23], "hamazaki": 49, "hame": 23, "hamei": [6, 50], "hamish": [36, 50], "hammel": 3, "han": [2, 3, 4, 14, 15, 16, 17, 26, 37, 49, 50], "hana": [15, 26], "hananeh": [7, 11, 17, 27, 28, 34, 48], "hand": [1, 4, 7, 9, 14, 17, 23, 24, 25, 26, 28, 36, 38, 40, 49, 51], "handbook": 40, "handi": 24, "handl": [1, 3, 7, 10, 18, 21, 23, 24, 36], "handler": 27, "handong": 5, "handwritten": 16, "hang": 40, "hanha": 26, "hani": 9, "haniffa": [2, 25, 50], "hanjani": 49, "hankeln": 23, "hannah": [5, 14, 16, 19, 37, 40, 41, 50, 51], "hannani": 36, "hanrui": 49, "hansen": [19, 22, 51], "hansi": 25, "hao": [5, 7, 14, 16, 19, 27, 28, 36, 37, 38, 48, 49, 50], "haorong": 37, "haoyan": 37, "happen": [7, 11, 16, 23, 25, 26, 36, 48], "harbor": 2, "hard": [5, 24, 26, 29, 34, 45, 48], "hardhat_1": 25, "hardwar": 26, "hardwork": 0, "harind": 23, "harismendi": 25, "harm": [2, 24], "harmon": [5, 9, 11, 16], "harmoni": [7, 28], "harmony_pca": [27, 28], "harmonypi": [43, 44, 45, 46, 47, 48], "harold": [16, 23, 47, 48, 50], "harri": 24, "hartigan": 49, "hartman": 27, "harvei": [7, 23], "harvest": 49, "has_ir": [2, 3, 4], "has_vdjdb_overlap": 4, "hash": [10, 16, 17, 34], "hashtag": 16, "hat": 36, "hata": [48, 50], "hatti": 7, "hatton": [3, 4], "hauser": 4, "hauser_ab15": 4, "hauser_ab16": 4, "hauser_ab17": 4, "hauser_ab19": 4, "have": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "havenar": 2, "hawrylycz": 24, "hayashi": 24, "hayat": 36, "hayden": 24, "hazard": 2, "hb": [17, 34], "hba1": [5, 12], "hba2": [5, 12, 26], "hbb": [5, 12, 24], "hbc": 23, "hbm": [5, 12], "hc": [4, 38], "hcv": 4, "hdf5": [19, 28], "hdf5r": 21, "hdi": 13, "hdim": 3, "hdo": 25, "hdst": 39, "he": [5, 7, 23, 24, 49, 50, 51], "head": [2, 3, 4, 10, 11, 14, 15, 19, 21, 25, 26, 36, 41, 48, 49], "header": [4, 19], "health": [5, 7, 19, 24, 50], "healthi": [1, 2, 3, 5, 13, 14, 15, 17, 19, 26, 28, 29, 34, 48], "healthy_sampl": 13, "healthy_tissu": 13, "healty_vs_covid": 17, "heather": [24, 49], "heatmap": [1, 4, 8, 14, 16, 25, 26, 49], "heatmap_cat": 1, "heavi": [1, 2, 3, 4, 24, 49], "heavili": [2, 4, 6, 16, 30, 34, 49], "hebenstreit": 24, "hechen": 49, "hector": [19, 22], "hedestam": 1, "hediyeh": [14, 15], "heger": 23, "heiden": 1, "height": [3, 8, 15, 42], "heiko": [7, 11, 27, 28, 34, 48, 51], "heim": [17, 26], "heimberg": 7, "hein": [17, 26], "heinrich": 24, "heinzlmeier": 24, "heiser": 23, "heladia": 26, "held": 16, "helen": [23, 49], "helga": 15, "heligmosomoid": 13, "heller": 13, "hellmann": [23, 24], "hellmuth": 17, "helmholtz": 30, "helminth": 13, "help": [0, 1, 3, 4, 5, 6, 7, 8, 11, 13, 16, 19, 21, 23, 24, 26, 27, 30, 33, 36, 38, 40, 41, 45, 48, 49, 50, 51], "helper": [5, 14, 23, 25, 27], "helpfulli": 7, "hemato": 17, "hematologi": 49, "hematopoiesi": [5, 49], "hematopoiet": [1, 5, 38, 49, 50], "hemberg": 7, "hemoglobin": [24, 34], "hemoglobulin": 5, "henao": 1, "henc": [1, 3, 5, 6, 8, 13, 14, 15, 16, 19, 24, 25, 26, 27, 28, 32, 34, 36, 37, 38, 40, 44, 49], "henceforth": [24, 50], "henderson": [13, 49, 50], "hendrickson": 23, "hendrik": [23, 36], "heng": 23, "hengwei": 49, "henikoff": 4, "hennig": 50, "henri": 13, "henrik": [7, 17, 26], "heonjong": 26, "herbert": [5, 7, 17, 25, 26, 50, 51], "herbst": [13, 22], "herc6": 25, "here": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 38, 40, 41, 44, 48, 49, 50, 51], "here_1": 8, "herebi": [13, 25], "hereditari": [18, 24], "herit": 49, "herman": 15, "hermann": [16, 23], "herold": 13, "herrig": 49, "hertz": [3, 4], "herv": [19, 22], "hes4": 3, "hesselberth": 5, "hession": 24, "hesx1": 14, "heterochromatin": 9, "heterogen": [1, 7, 14, 15, 17, 21, 23, 24, 30, 32, 33, 49, 50], "heteromer": 25, "heterotyp": [11, 34, 46], "hetzel": [5, 36, 38], "hetzer": 9, "heumo": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "heurist": [7, 23, 33, 49], "heutink": 17, "hewitson": 5, "heyn": [15, 24, 36, 39], "hg19": 8, "hg38": [8, 10, 11, 26], "hg38_1": 8, "hg38__refseq": 26, "hgnc": 26, "hh92": 4, "hh_s5f": 1, "hhan": [27, 28], "hi": [5, 8, 12, 24], "hick": [14, 22, 23, 32], "hickei": [21, 23], "hidden": [16, 24, 37, 42], "hide": [9, 24], "hideto": 49, "hie": 7, "hierarch": [1, 4, 19, 21, 36, 49, 50], "hierarchi": [3, 4, 5, 13, 21, 50], "high": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 29, 31, 32, 34, 36, 37, 40, 46, 49, 50, 51], "high_confid": [1, 2], "higher": [1, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 31, 34, 37, 46, 49, 50, 51], "highest": [1, 5, 7, 11, 14, 16, 17, 19, 23, 25, 28, 31, 34, 37], "highest_expr_gen": 19, "highli": [1, 2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 29, 31, 32, 38, 41, 43, 49, 50, 51], "highlight": [1, 3, 5, 6, 9, 13, 14, 16, 22, 23, 25, 26, 33, 34, 39, 49], "highly_devi": [5, 31, 32], "highly_vari": [3, 5, 7, 13, 15, 17, 21, 26, 27, 28, 31, 37], "highly_variable_gen": [3, 7, 13, 15, 16, 17, 19, 21, 26, 32, 50, 51], "highly_variable_intersect": 7, "highly_variable_nbatch": 7, "highly_variable_rank": [15, 37], "highs_wrapp": 1, "hill": 23, "hindson": [23, 24], "hint": [1, 36], "hippen": 23, "hippenstiel": [17, 26], "hirak": [23, 51], "hire": 36, "hiroaki": 49, "hirokawa": 24, "hirsch": 51, "hirschstein": 24, "hist": [13, 26], "histocompat": 2, "histogram": [4, 11, 13, 19, 23, 26, 36], "histolog": [36, 37], "histologi": [36, 41], "histon": 9, "histori": [36, 49], "histplot": [4, 11, 33], "hit": [4, 23, 49, 50], "hiv": 4, "hj": [23, 51], "hla": [4, 25, 27, 45], "hla_dqb1": 25, "hle": 7, "hler": 25, "hll": 49, "hlmann": 15, "hm": 44, "hmac": 2, "hmgb1": 25, "hmgb2": 26, "hmisc": 25, "hmisc_4": 25, "hmrf": 37, "hms_1": [8, 25], "hnemann": 14, "ho": [3, 4, 16, 23, 44, 49], "hoa": 7, "hoc": [13, 23], "hochberg": [13, 14], "hochgern": [50, 51], "hock": [17, 26], "hodg": 24, "hoeft": 36, "hoern": 29, "hofbauer": 5, "hoffman": [5, 7, 14, 19, 27, 28], "hoi": [23, 49, 51], "hold": [7, 19, 51], "holger": [15, 17, 24, 26, 36, 39], "holist": 28, "holland": [15, 26], "hollei": 24, "holm": 25, "holmberg": [19, 37, 40, 41], "holmer": 14, "home": [1, 2, 4, 5, 8, 10, 19, 25, 36, 37, 41, 49, 50], "homeostasi": [24, 25], "homo": 4, "homo_sapien": 26, "homogen": [17, 19, 24], "homolog": 24, "homologi": 4, "homosapien": 4, "homotyp": [11, 34], "honei": [7, 11, 27, 28, 34, 48], "honeycomb": 24, "hong": [7, 37, 51], "hongbo": 2, "hongkai": 49, "hongkui": [5, 24], "honglei": [39, 41], "hongseok": 26, "hongyu": 3, "hood": 24, "hoogduin": 5, "hoogenboezem": 36, "hook": [24, 28], "hooshiar": [5, 7, 50], "hop": 23, "horizont": [11, 19], "horizontal_gap": 36, "horkova": 43, "hormoz": 49, "horn": [17, 26], "horsfal": 50, "horvath": [5, 13], "horwitz": 49, "host": [2, 23, 24, 34, 49, 50], "hou": [7, 9, 25], "houck": [16, 47, 48, 50], "hour": [11, 16], "hover": 42, "how": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 39, 40, 41, 44, 48, 49, 50, 51], "howard": [9, 50], "howev": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 34, 37, 38, 39, 41, 43, 48, 49, 50, 51], "howitt": [13, 22], "howlett": 5, "hpca": 17, "hpgt21": 25, "hpoli": 13, "hpoly_timecours": 13, "hpu": [5, 7, 16, 27, 28, 36], "hratch": 25, "hrdlickova": 24, "hrnb01": 49, "hsapien": [8, 10, 11], "hsc": [5, 7, 12, 38], "hsc_1": 50, "hsc_2": 50, "hsiang": 25, "hsk": 27, "hsp90b1": [5, 12], "hspc": 12, "hstack": 19, "hsv": 4, "html": [1, 3, 5, 6, 15, 16, 19, 21, 23, 27, 28, 42, 50], "html5": 15, "html_code": 42, "htmltable_2": 25, "htmltool": [7, 21], "htmltools_0": [8, 25, 27, 28], "htmlwidget": [7, 21], "htmlwidgets_1": [8, 25, 27, 28], "hto": 16, "hto_classif": [16, 17], "hto_margin": 17, "hto_maxid": 17, "hto_secondid": 17, "http": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "httpuv": [7, 21], "httpuv_1": [8, 25, 27, 28], "httr": [7, 21], "httr_1": [8, 25, 27, 28], "hu": [2, 7, 8, 14, 15, 17, 25, 36, 37, 38, 39, 41, 49, 50], "hua": 25, "huachen": 5, "huan": [14, 25, 49], "huang": [3, 4, 5, 7, 13, 15, 23, 24, 37, 39, 48, 49, 50, 51], "huanm": 37, "huat": 37, "huber": [14, 19, 22, 33], "hudel": [14, 16], "hue": [13, 16, 32, 38, 48], "huelsenbeck": 49, "hufnagel": 7, "huge": [24, 25], "hugh": 24, "hughei": 23, "hugo": 5, "hui": [37, 49], "huidong": 11, "huifang": 37, "huipeng": 37, "huiwen": 37, "hulselman": [8, 9, 15, 26], "hum": 49, "human": [1, 2, 3, 4, 5, 7, 9, 10, 16, 17, 19, 23, 24, 25, 26, 28, 30, 34, 36, 40, 45, 48, 49, 51], "humantf": 8, "humphrei": 23, "hundr": [16, 23, 24, 38, 45, 48], "hunkapil": 24, "hurlei": 49, "hussain": 50, "hussmann": [16, 49], "hutson": [14, 16], "hutzenlaub": 23, "huynh": [7, 11, 15, 26, 27, 28, 34, 48], "hvg": [7, 13, 15, 17, 21, 26, 27, 28, 37, 41], "hvg_overlap": [7, 28], "hwan": [47, 48], "hwang": [17, 50, 51], "hybrid": [18, 24, 25, 38, 49], "hybridsolv": 49, "hydrogel": 24, "hydrogen": 24, "hyeon": 26, "hyoj": 17, "hyojin": [25, 26], "hypergeom_ufunc": [7, 15, 21, 25], "hypergeometr": 15, "hypermut": [1, 2, 4], "hyperparamet": [3, 36, 49], "hypothalamu": 41, "hypothes": [1, 25, 37, 51], "hypothesi": [11, 13, 15, 16, 25], "hyun": [14, 15, 16, 25, 50], "hyung": 2, "hzxd16": 2, "i": [0, 1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 12, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "i1": 7, "i192": 23, "i200": 23, "i386": [7, 15, 21], "i610": 16, "i617": 16, "iain": [24, 30], "ian": [4, 7, 23, 24, 51], "ibarra": [5, 7, 8, 16, 19, 26, 37, 40, 41, 50], "ibrahim": [15, 23, 26], "ic50": 16, "ica": [7, 21], "ica_1": [25, 27, 28], "icam1": [25, 27], "icb": [1, 4, 5, 10, 36, 37, 41], "ico": [27, 48], "icoresi": 25, "id": [1, 2, 3, 4, 5, 11, 15, 16, 17, 19, 26, 27, 28, 31, 34, 40, 42, 48, 50], "id2": [5, 12], "ida": 2, "idea": [2, 5, 7, 11, 13, 16, 19, 21, 22, 24, 25, 38, 47], "ideal": [5, 11, 13, 15, 23, 24, 25, 36], "idek": [15, 49], "ident": [1, 2, 3, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 33, 38, 39, 48, 49, 50], "identif": [1, 4, 5, 6, 11, 14, 15, 16, 18, 23, 24, 26, 33, 34, 36, 37, 40, 41, 43, 48, 49], "identifi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 18, 19, 23, 24, 25, 26, 31, 32, 34, 36, 37, 38, 41, 42, 43, 46, 48, 49, 50, 51], "identncount_rnanfeature_rnancount_atacnfeature_atacncount_gene_activitynfeature_gene_activityn_features_per_celltotal_fragment_countslog_total_fragment_count": 10, "idf": [27, 28], "idiosyncrat": 23, "idna": [1, 21], "ido": [4, 36, 50], "ids2indic": 15, "idx": [15, 32], "idx_atac_queri": 27, "idx_cite_queri": 27, "idx_mutiome_queri": 27, "idx_out_dir": 23, "idx_scrna_queri": 27, "iedb": 4, "ieee": 50, "ifels": 14, "ifgn": 16, "ifgnr2": 16, "ifi16": 25, "ifi6": [16, 25], "ifih1": 25, "ifit1": 25, "ifit2": 25, "ifit3": 25, "ifitm3": 15, "ifn": [15, 25], "ifn_pathwai": 15, "ifng": 3, "ifngr1": 16, "ifngr2": 16, "ifram": 3, "ig": [1, 2, 36], "iga": 5, "igd": [12, 27], "igg": 1, "igg1": [45, 47], "igg2a": [45, 47], "igg2b": [45, 47], "igh": [1, 2], "igha1": 2, "ighd": [2, 5, 12, 27], "ighd2": 2, "ighd3": 2, "ighd5": 2, "ighg1": 2, "ighj4": 2, "ighj5": 2, "ighj6": 2, "ighm": [2, 5, 12, 27], "ighv1": [1, 2], "ighv3": [1, 2], "ighv5": 2, "igkc": [2, 5, 12], "igkj1": 4, "igkj2": 4, "igkj3": 2, "igkv1": 2, "igkv3": 2, "igkv6": 2, "igl": 2, "iglc1": 2, "iglc2": 2, "iglc3": 2, "iglj1": 2, "iglj3": 2, "iglj5": 2, "igll1": [5, 12], "iglv1": 2, "iglv3": 2, "iglv4": 2, "igm": [1, 27, 45], "ignacio": [5, 7, 8, 16, 19, 26, 37, 40, 41, 50], "ignati": 49, "ignit": 27, "ignor": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 23, 25, 26, 27, 28, 36, 47], "ignore_index": 7, "igo": 23, "igor": [50, 51], "igraph": [1, 6, 7, 19, 21], "igraph_1": [8, 25, 27, 28], "ihc": 39, "ii": [4, 49], "iii": [14, 19, 49], "ij": 38, "ik": 38, "il": 49, "il1rn": 14, "il2ra": 27, "il2rb": 27, "il3ra": [5, 12], "il4r": [5, 12, 27], "il6st": 15, "il7r": [5, 12, 27], "ilc": [5, 7, 12], "ilc1": [5, 12], "ilc2": 5, "ilc3": 5, "ilia": [1, 7, 19, 23, 41, 48], "ilisi": [7, 28], "ilk": 24, "ill": 2, "illinoi": 9, "illumina": [2, 19, 23, 24], "illustr": [1, 9, 13, 15, 23, 37], "iloc": [5, 19], "ilpsolv": 49, "ilya": [5, 7, 44], "im": 8, "imag": [1, 8, 11, 16, 19, 23, 24, 26, 36, 37, 38, 39, 49], "imager_0": 8, "imagin": [0, 7, 19, 49], "imaz": 51, "imbal": 13, "imc": 39, "img": 37, "img_kei": 36, "imit": 27, "immatur": 17, "immcant": 1, "immedi": [1, 31], "immens": 2, "immobil": 2, "immun": [1, 3, 4, 5, 9, 13, 16, 17, 18, 43, 48, 50], "immunarch": 2, "immune_all_high": 5, "immune_all_low": 5, "immunecod": 4, "immunis": 4, "immunodomin": 1, "immunogen": 4, "immunogenet": 17, "immunoglobulin": [1, 2], "immunoinformat": 2, "immunolog": [1, 15], "immunologi": [1, 2, 4, 17], "immunomagnet": 2, "immunomind": 2, "immunomindteam19": 2, "immunoprecipit": 25, "impact": [6, 9, 13, 15, 17, 33, 37, 49], "imper": 49, "imperfect": [5, 23], "implaus": 23, "implement": [1, 2, 4, 6, 8, 11, 13, 14, 15, 16, 19, 21, 23, 25, 31, 33, 40, 41, 47, 48, 49, 51], "impli": [4, 23, 25, 33], "implic": [5, 13, 15, 24, 49], "implicitmodificationwarn": [1, 4, 25], "import": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "import_builtin": 21, "important_featur": 16, "importantli": [5, 8, 19, 25, 49], "importlib_metadata": [7, 15, 21], "importlib_resourc": [1, 21], "imposs": [3, 13, 16, 49, 50], "impract": 21, "imprecis": 1, "impress": 5, "improv": [1, 3, 5, 6, 7, 9, 11, 14, 15, 16, 17, 21, 23, 25, 27, 28, 30, 33, 43, 48, 49, 51], "imput": [18, 28], "imrichova": [15, 26], "in_tissu": [36, 37], "inabl": 13, "inaccur": [16, 18, 23, 26], "inaccuraci": [4, 14, 23], "inadequ": 15, "inanim": 24, "inapplic": 51, "inappropri": 48, "inbal": [7, 38], "inbuilt": 21, "incid": 23, "inclin": 38, "includ": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 41, 43, 48, 49, 50, 51], "include_ref_col": 4, "inclus": [13, 23, 25], "incompat": 46, "incomplet": [2, 4, 23, 26, 48], "inconsist": [7, 15, 21, 38], "incorpor": [4, 5, 7, 13, 18, 23, 24, 26, 28, 34, 36, 37, 49], "incorrect": [2, 23, 42, 51], "incorrectli": 49, "increas": [1, 3, 4, 7, 8, 13, 14, 16, 18, 23, 24, 25, 26, 32, 36, 38, 40, 43, 46, 48, 49, 50], "increasingli": [3, 29], "ind": 15, "ind_x": 36, "inde": [14, 15, 16, 17, 40], "indel": 49, "indel_prior": 49, "independ": [1, 3, 4, 5, 9, 13, 14, 15, 16, 18, 19, 22, 23, 25, 26, 30, 31, 33, 36, 38, 49, 51], "inderbitzin": 2, "index": [1, 2, 3, 4, 5, 8, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 33, 34, 36, 37, 41, 45, 46, 48, 49, 51], "index_cel": 13, "index_col": [2, 3, 4, 5, 17, 26, 49], "index_dir": 23, "index_not_tf": 8, "index_tf": 8, "index_uniqu": 5, "indic": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 28, 32, 33, 34, 36, 38, 40, 41, 49], "indistinguish": 24, "individu": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 19, 22, 23, 24, 25, 26, 30, 34, 36, 38, 39, 48, 49, 50, 51], "indptr": 15, "indrop": [18, 24], "indu": 14, "induc": [7, 8, 13, 14, 16, 24, 25, 49], "induct": [16, 25, 49, 51], "inecik": 5, "ineffici": 13, "inen": 23, "inevit": 29, "inf": [14, 16, 25], "inf_av": 36, "infarct": 36, "infect": [1, 3, 4, 13, 24], "infecti": 2, "infer": [2, 3, 4, 5, 6, 7, 9, 13, 14, 16, 17, 18, 19, 23, 26, 27, 34, 36, 38], "inferenti": 14, "inflammatori": [2, 3], "inflat": [5, 14, 16, 23, 50], "inflect": 23, "inflict": 16, "influenc": [1, 3, 4, 6, 8, 9, 13, 15, 16, 17, 23, 24, 26], "influenzaa": 4, "info": [5, 6, 7, 13, 14, 21, 28, 31, 32, 33, 34, 36, 38, 44], "inform": [1, 2, 3, 4, 5, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 34, 36, 37, 38, 39, 43, 44, 45, 48, 49, 50, 51], "infrequ": 23, "ingo": 51, "ingraham": 16, "inhal": 49, "inher": [3, 5, 13, 14, 15, 23, 30, 31, 51], "inherit": [2, 24], "inhibit": [8, 18], "inhibitor": 2, "inhibitori": 16, "inigo": 49, "initi": [1, 2, 3, 5, 6, 11, 13, 14, 17, 18, 21, 22, 23, 25, 26, 27, 28, 31, 34, 37, 44, 50], "initial_clust": [1, 2, 4], "inject": 26, "inlin": 42, "innat": 1, "inner": 42, "innerhtml": 42, "innocu": 34, "innov": 24, "inplac": [1, 5, 11, 16, 19, 21, 25, 33, 34, 36, 48], "input": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 30, 33, 34, 36, 37, 42, 47, 49], "input_data": 3, "input_group": 33, "input_sequ": 4, "inquiri": 30, "inscrib": 49, "insert": [2, 9, 18, 19, 23, 49], "insid": [1, 2, 11, 15, 18, 19, 23, 24], "insight": [2, 3, 5, 9, 13, 15, 17, 18, 23, 25, 26, 34, 49, 50], "inspect": [5, 6, 7, 8, 14, 16, 26, 32, 33, 34, 36, 37, 38, 41], "inspir": [13, 19, 22], "instabl": [4, 49], "instal": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "install_github": [8, 21, 25, 27], "instanc": [1, 11, 19, 21, 23, 26, 27, 28, 41, 50], "instantan": 24, "instanti": [13, 49], "instead": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 15, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 34, 36, 38, 41, 47, 50, 51], "institut": 49, "instruct": [3, 18, 23, 30, 50], "instrument": [19, 24], "instrument_typ": 19, "insuffici": 23, "insuk": 26, "int": [2, 4, 7, 10, 13, 15, 26, 34, 42, 48], "int64": [1, 2, 4, 5, 7, 11, 16, 17, 26, 34, 47], "intacsm21": 7, "intact": 34, "intbh": 7, "intbuttnermw": 7, "intcgvdkh21": 7, "integ": [7, 19, 27, 34], "integr": [2, 4, 5, 9, 11, 13, 14, 15, 17, 18, 19, 23, 25, 26, 29, 30, 34, 36, 38, 41, 44, 47, 48, 49, 50], "integrate_on": 27, "integrated_expr": 7, "integrated_snn_r": [14, 15, 16, 25], "integratedata": [7, 28], "integration_introduct": [27, 28], "integrinb7": 12, "intel": 23, "intellig": 3, "intend": 25, "intens": [5, 16, 23, 24, 37], "intent": 36, "inter": [15, 17, 25], "interact": [2, 3, 4, 8, 15, 16, 17, 18, 19, 21, 24, 26, 37, 42], "interaction_matrix": 40, "intercept": 13, "intercept_df": 13, "interchang": [7, 15], "interdepend": 3, "interest": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 18, 22, 23, 24, 26, 27, 28, 30, 34, 36, 37, 38, 39, 40, 48, 49], "interestingli": [13, 37], "interf": 18, "interfac": [2, 4, 7, 17, 21, 23], "interfer": [18, 23], "interferon": [3, 14, 15], "intergen": 18, "interlandi": [5, 7, 28], "interlink": [3, 16], "intermedi": [5, 11, 14, 23, 24], "intermix": 44, "intern": [3, 4, 7, 13, 17, 19, 23, 49], "interneuron": 24, "interoper": 19, "interoperability2": 21, "interoperabilti": 21, "interp_1": 25, "interplai": [9, 25], "interpret": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 17, 19, 23, 25, 28, 31, 34, 41, 51], "interquartil": 23, "interrog": 49, "intersect": [2, 5, 19, 25, 27, 28, 38], "intersect1d": 17, "intersect_ob": 19, "interspers": 11, "interv": [10, 11, 13, 18, 19, 34, 36, 40], "intestin": [5, 13, 22], "intglx": 7, "inthbb19": 7, "inthlmm18": 7, "intjlr07": 7, "intkmf": 7, "intlbc": 7, "intlbuttnerc": 7, "intllb": 7, "intlrc": 7, "intlt19": 7, "intlwt19": 7, "intmemoir": 49, "intml": 7, "intpolanskipi": 7, "intpzo17": 7, "intra": [6, 17, 25], "intracellular": [25, 48], "intract": 36, "intratumor": 49, "intraven": 2, "intrigu": [3, 48], "intrins": [7, 16], "introduc": [2, 4, 11, 13, 14, 15, 16, 19, 21, 22, 23, 24, 30, 32, 33, 34, 36, 39, 41, 48, 49], "introduct": [1, 10, 19, 22, 25, 34, 39, 49], "intron": [18, 23, 51], "intsbh": 7, "intsfg": 7, "intsfhm21": 7, "intssz": 7, "inttac": 7, "intuit": [8, 23, 50], "intvdbsvertesi": 7, "intwkl12": 7, "intxlm": 7, "invad": 2, "invalid": [1, 13, 17, 23], "invalid_argu": 5, "invers": [3, 19, 25], "inverse_colour": 25, "inverse_s": 25, "invert": 1, "investig": [3, 14, 16, 23, 24, 38, 49, 51], "invgauss_ufunc": 25, "invis": 5, "invit": [30, 37], "involv": [1, 4, 5, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 30, 32, 34], "inzani": 51, "io": [2, 5, 6, 7, 15, 19, 21, 27, 28, 49, 50], "ioana": 2, "ioanni": 1, "ion": [14, 24], "iona": 47, "iop": 6, "ippolito": 3, "ipred_0": 25, "iprogress": [1, 2, 3, 4, 5, 6, 15, 50], "ipu": [5, 7, 16, 27, 28, 36], "ipykernel": [1, 7, 15, 21, 25], "ipykernel_65366": 49, "ipynb": 50, "ipython": [1, 3, 7, 11, 14, 15, 17, 21, 25, 27, 28, 32, 33, 34, 42], "ipython_genutil": [1, 7, 21, 25], "ipywidget": [1, 5, 6, 7, 15, 21, 25, 50], "ir": [1, 3, 4], "ir_dist": [1, 4], "ir_dist_aa_": 4, "ir_queri": 4, "ir_query_annot": 4, "ir_v": 2, "ir_vdj_1_c_cal": 2, "ir_vdj_1_d_cal": 1, "ir_vdj_1_j_cal": 4, "ir_vdj_1_junction_aa": [1, 3, 4], "ir_vdj_1_product": 2, "ir_vdj_1_v_cal": [1, 2, 4], "ir_vdj_1_v_cigar": 4, "ir_vdj_2_c_cal": 2, "ir_vdj_2_junction_aa": 4, "ir_vdj_2_locu": 2, "ir_vdj_2_product": 2, "ir_vdj_2_sequence_id": 4, "ir_vdj_2_v_cal": [2, 4], "ir_vdj_2_v_cigar": 4, "ir_vj_1_c_cal": 2, "ir_vj_1_consensus_count": 2, "ir_vj_1_h_cal": 4, "ir_vj_1_j_cal": 4, "ir_vj_1_junction_aa": [1, 3, 4], "ir_vj_1_product": 2, "ir_vj_1_v_cal": [1, 2, 4], "ir_vj_1_v_cigar": 4, "ir_vj_2_c_cal": 2, "ir_vj_2_consensus_count": 2, "ir_vj_2_junction_aa": 4, "ir_vj_2_product": 2, "ir_vj_2_v_cal": [2, 4], "ir_vj_2_v_cigar": 4, "irang": [7, 11, 21], "iranges_2": [8, 15, 25, 27, 28], "irdisplay_1": 8, "iren": [23, 50], "irepan": 49, "irf1": 16, "irf4": [5, 12], "irf7": 25, "irizarri": [14, 19, 22, 32, 36], "irkernel": [8, 11], "irkernel_1": 8, "irlba": [7, 21], "irlba_2": [25, 27, 28], "iroot": 50, "irregular": 23, "irwin": [37, 41], "is_cel": [1, 2], "is_fil": 15, "is_latest": 50, "is_outli": [34, 48], "is_tf": 8, "is_train": [27, 28, 38], "is_view": 19, "isaac": [15, 19, 21, 37, 40, 41, 50], "isabella": 51, "isacco": [7, 11, 27, 28, 34, 48], "isback": 19, "isbel": 9, "isbn": 40, "isg15": [3, 15, 16], "isg20": 16, "ishaan": 24, "ishaqu": 40, "ishiguro": 49, "isin": [1, 2, 3, 4, 5, 7, 15, 17, 19, 25, 26, 27, 28, 45, 49], "isinst": 15, "islam": [23, 24, 50], "island": [16, 18, 24], "isn": 7, "isna": [3, 4], "isnan": 17, "isodur": 21, "isoform": 24, "isol": [7, 11, 23, 24, 28], "isolated_label_f1": [7, 28], "isolated_label_silhouett": [7, 28], "isolated_labels_asw_": 28, "isometr": 13, "isotyp": [1, 45, 47, 48], "isotype_control": [45, 47], "isotype_statu": 1, "isr": 23, "issac": 50, "isspars": 33, "issu": [4, 7, 11, 13, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 30, 33, 36, 39], "itai": [13, 17, 22, 23, 24, 49], "item": [3, 5, 7, 15, 19, 21, 41, 42], "iter": [3, 7, 8, 11, 15, 16, 42, 44, 49], "iterators_1": [8, 25], "iteritem": 15, "iterrow": 7, "itertool": [15, 17], "itga": 27, "itga1": 27, "itga2b": [5, 12], "itga6": 27, "itgam": 27, "itgax": 27, "itgb1": [5, 12, 27], "itgb2": 25, "itoshi": 24, "its": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 13, 16, 19, 21, 22, 23, 24, 25, 34, 36, 37, 38, 41, 49, 50, 51], "itself": [1, 6, 7, 13, 16, 19, 23, 25, 36, 38, 50, 51], "itu_intub": 2, "itu_o2": 2, "iv": 49, "ivan": [4, 7, 25, 36, 51], "ivi": 23, "ivlp": 4, "ivo": [24, 36], "iwo": 50, "j": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, 36, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "j_": 2, "j_call": 1, "j_call_b_vdj": 1, "j_call_b_vj": 1, "j_call_vdj": 1, "j_call_vj": 1, "j_cigar": 1, "j_field": 1, "j_gene": 2, "jaakkola": 14, "jabbari": 23, "jaccard": 1, "jacinta": 9, "jack": 49, "jackson": [5, 7, 13, 16, 24, 50], "jacob": [3, 4, 17, 23, 26, 50, 51], "jacqu": 11, "jae": 25, "jafar": 23, "jaff": [13, 24], "jagadeesh": 7, "jahn": 14, "jai": [5, 13, 23, 49], "jaim": 4, "jain": [5, 7, 14, 19, 24, 27, 28, 36, 50], "jaison": [5, 14, 19, 27, 28], "jaiswal": 7, "jak2": [15, 16], "jakmip1": 12, "jakob": 24, "jamal": 49, "jame": [2, 5, 14, 16, 19, 22, 23, 24, 25, 26, 36, 48, 49, 50], "jami": [5, 37], "jamison": 24, "jan": [1, 5, 14, 15, 16, 17, 23, 24, 25, 26, 28, 36, 37, 49, 50], "jana": [15, 37], "janbandhu": 23, "jane": 50, "janin": [5, 7, 50, 51], "janjic": 24, "janjuha": 49, "januari": [7, 26, 41, 50, 51], "jarci": [17, 26], "jardin": 50, "jarosch": 3, "jarvi": 5, "jase": [23, 51], "jasmijn": 14, "jasmin": 51, "jason": [1, 4, 5, 8, 11, 14, 23, 24, 37, 38, 50], "jasper": [8, 9, 26], "jaum": 50, "javier": [15, 49], "jax": [7, 16], "jaxlib": [5, 7], "jayaraj": [5, 7, 50], "jayasuriya": 7, "jc": 49, "jchain": [5, 12], "jdb_palett": 8, "je": 15, "jean": [6, 7, 13, 15, 26, 37, 44, 49, 50, 51], "jeana": 9, "jeann": [5, 7, 50], "jedi": [1, 7, 15, 21, 25], "jeff": 24, "jeffrei": [3, 5, 7, 9, 16, 27, 28, 38, 39, 44, 49, 50], "jelinski": 36, "jell": 15, "jen": 2, "jeng": 50, "jennif": [4, 8, 13, 17, 23, 24, 38, 48, 49, 51], "jensen": 23, "jeopardi": 48, "jerald": [23, 24], "jerbi": 16, "jerelyn": 48, "jeremi": [3, 4, 24], "jeroen": 14, "jerold": 15, "jess": 5, "jessen": 4, "jessica": [5, 7, 16, 23, 24, 34], "jessurun": 14, "jesu": 5, "jew": 23, "jgjz": 25, "jha": 23, "ji": [3, 4, 5, 7, 16, 37, 49, 50], "jia": [7, 11, 27, 28, 34, 48], "jiacheng": 24, "jiami": 2, "jian": [7, 15, 17, 26, 37, 41, 49, 50], "jianbin": 24, "jiang": [7, 15, 26, 37], "jiangshan": 37, "jianni": 23, "jianzhong": 15, "jiaqiang": 41, "jiarui": 24, "jiaxin": 26, "jiayi": 16, "jie": [5, 7, 27], "jihan": 23, "jill": 15, "jim": [50, 51], "jimin": [50, 51], "jimmi": 23, "jin": [25, 26, 37, 49], "jing": [25, 51], "jingyi": 34, "jingyuan": [14, 49], "jinja2": [1, 7, 15, 21, 25], "jinmiao": 7, "jinyuan": 15, "jiongsong": 39, "jitter": 19, "jk": 38, "jkq": 49, "jl": 21, "jmg": 49, "jo": 16, "joachim": [5, 7, 17, 23, 24, 26, 50], "joakim": [5, 6, 36, 41, 50], "joann": 51, "joaquin": [7, 11, 27, 28, 34, 48], "job": [15, 16], "joblib": [1, 7, 15, 21, 25], "joe": [23, 24], "joel": [1, 48], "joelostblom": 1, "joep": 50, "joglekar": 24, "johan": 15, "johann": [13, 14, 16, 24], "john": [5, 7, 13, 14, 15, 16, 23, 24, 28, 47, 49, 50, 51], "johnson": [7, 34], "joi": 2, "join": [3, 5, 7, 14, 15, 18, 19, 24, 26, 27, 28, 30, 49], "joint": [0, 3, 5, 7, 13, 19, 27, 28, 37, 38, 48], "joint_graph": 37, "jointli": [0, 2, 3, 5, 11, 19, 27, 34, 36, 37, 44, 48], "jointplot": 11, "jolli": 49, "jona": [7, 17, 25, 26], "jonathan": [5, 7, 11, 16, 24, 27, 28, 34, 48, 49, 50, 51], "jone": [5, 15, 24, 49, 50], "jong": [7, 15], "joon": [7, 11, 27, 28, 34, 48], "joonhyuk": 49, "joost": [23, 24, 26], "jordan": [5, 7, 14, 16, 25, 28, 36, 38, 44, 49], "jordi": [6, 50], "jorg": 23, "jorja": 4, "joseph": [2, 5, 7, 9, 15, 16, 23, 36, 49, 50], "josephin": 2, "joshua": [7, 23, 24, 34, 49, 51], "josi": [7, 49], "jost": 49, "jos\u00e9": 36, "jou": 24, "joughin": 15, "journal": [1, 2, 5, 6, 13, 14, 15, 23, 24, 39, 49, 50, 51], "jovan": [15, 36], "joyc": [2, 5], "jo\u00e3o": [17, 25], "jpeg_0": [8, 25], "jph3": 41, "jr": [1, 49], "json": [5, 21, 23], "json5": [1, 21], "jsonlit": [7, 21], "jsonlite_1": [8, 25, 27, 28], "jsonpoint": 21, "jsonschema": [1, 21], "jsonschema_specif": 21, "jt": 3, "ju": 49, "juan": [1, 13, 23], "juarez": 25, "jul": [17, 23, 24, 25], "jule": [7, 38], "juli": [5, 13, 23, 24, 50, 51], "julia": [7, 24, 50], "juliana": [5, 14, 19, 27, 28], "julien": [9, 28], "julio": [15, 25, 26, 36], "jump": [34, 36], "jun": [7, 12, 13, 14, 24, 25, 36, 37, 38, 47, 48, 49], "junankar": [2, 24], "junb": 7, "junchen": 25, "junction": [1, 2, 18, 23, 25], "junction_aa": 1, "junction_aa_vdj": 1, "junction_aa_vj": 1, "junction_length": 1, "junction_vdj": 1, "junction_vj": 1, "june": [5, 7, 23, 26, 36, 38, 41, 50, 51], "junedh": 36, "jung": [26, 51], "junguo": 39, "junha": 26, "junhong": 49, "junhou": 37, "junhyong": 9, "junji": [23, 24], "junker": 49, "junttila": 14, "junyu": [16, 23], "jupyt": [5, 6, 15, 19, 21, 42, 49, 50, 51], "jupyter_cli": [1, 7, 15, 21, 25], "jupyter_cor": [1, 7, 15, 21, 25], "jupyter_ev": 21, "jupyter_serv": [1, 5, 7, 8, 11, 21, 26], "jupyterlab": [1, 5, 6, 7, 8, 11, 13, 16, 21, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 51], "jupyterlab_serv": [1, 21], "jurek": 36, "jussi": 24, "just": [1, 2, 7, 11, 13, 14, 15, 19, 21, 23, 25, 28, 34, 36, 41, 49, 50], "justifi": [42, 50], "justin": [7, 15, 25, 50, 51], "k": [2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 34, 36, 38, 40, 43, 47, 48, 49, 50, 51], "kaduk": 1, "kadur": [5, 7, 50], "kaeser": 15, "kaesler": 36, "kageyama": 3, "kai": [4, 9, 17, 25, 26], "kaibin": 5, "kaifu": 25, "kaihara": 24, "kailong": 37, "kaiser": [17, 26], "kaiwen": [3, 7], "kaixian": 49, "kaiyang": 23, "kalend": 26, "kalhor": 49, "kall": [17, 26], "kallisto": 23, "kalmykowa": 49, "kamath": 5, "kamil": [7, 44], "kamila": 1, "kamimoto": 49, "kaminow": 23, "kaminski": [5, 7, 25, 50], "kamitaki": [23, 24], "kan": 37, "kana": 21, "kanan": 24, "kaneshiro": 9, "kang": [5, 14, 15, 25, 26], "kang_2018": [14, 16], "kang_counts_25k": [15, 25], "kang_pbmc_con": 15, "kansa": 49, "kaori": 24, "kapello": [5, 7, 17, 26, 50], "kaper": 15, "kaplan": 4, "kappa": 23, "kappa_": 36, "kappert": [17, 26], "kar": 2, "karel": 24, "karen": 16, "karikomi": 25, "karin": [17, 36, 49], "karla": 24, "karlsson": [1, 24], "karlynn": 2, "karolin": 3, "karsten": [1, 2], "kartha": 8, "karthik": [7, 13, 22, 23, 24], "kasahara": 23, "kashani": [5, 7, 50], "kasidet": 7, "kasper": [14, 19, 22, 23, 24, 51], "kassner": 36, "kastriti": [50, 51], "kat": [19, 41, 48], "kate": 3, "kath": [14, 16], "katharina": [14, 51], "katherin": [3, 4, 7, 24, 25], "kathleen": [14, 49, 50], "kathryn": [3, 5, 16], "kati": 4, "katja": [13, 40, 50, 51], "katrin": [17, 26], "katz": [13, 22, 38], "kauffman": 2, "kavita": 3, "kaya": [14, 16], "kayle": [1, 2, 5, 7, 50], "kayli": [7, 11, 27, 28, 34, 48], "kb": 24, "kb19": 31, "kb_python": 23, "kbet": [7, 28], "kbp": 8, "kcen": 7, "kcnn3": 12, "kcnq5": [5, 12], "kde": [26, 33, 34], "kde_kw": [1, 3], "kde_norm": [1, 3], "kdeplot": 11, "kdr": 38, "ke": [4, 7, 36, 38, 41, 49], "kechen": 25, "kedaigl": 24, "kedar": 24, "kedlian": 36, "kedmi": 36, "kedzierska": [3, 4], "keep": [1, 2, 5, 7, 11, 14, 15, 16, 24, 25, 26, 27, 28, 30, 31, 36, 37], "keep_batch": 7, "keep_g": 15, "kegg": 15, "keggrest_1": 8, "kei": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51], "keiichiro": 49, "keim": 51, "keir": 50, "keith": [17, 23, 24], "keito": 49, "keizer": 14, "kelder": 24, "kellei": 23, "kelli": [24, 49, 50], "kelvin": [1, 2, 48, 50], "kemal": 5, "ken": 23, "kendel": 11, "kenichi": 5, "kenji": 49, "kenneth": 49, "kenni": 25, "kent": 5, "kepler": 1, "kept": [1, 2, 3, 25], "keren": 36, "kernel": [8, 24], "kernsmooth": [7, 21], "kernsmooth_2": [8, 25, 27, 28], "kerstin": [5, 7, 50], "kester": 31, "kevan": 13, "kevin": [1, 7, 17, 22, 23, 24, 26, 44, 49], "key": 51, "key_ad": [1, 3, 5, 6, 13, 14, 15, 33, 34, 37], "key_of_dataset": 50, "khajavi": 5, "khan": [2, 7], "kharchenko": [15, 50, 51], "khatri": 14, "khodadoust": 17, "khodaverdian": 49, "khozoi": [19, 29], "ki270711": 11, "ki270713": 11, "ki270721": 11, "ki270726": 11, "ki270727": 11, "ki270728": 11, "ki270731": 11, "ki270734": 11, "kian": 49, "kibayashi": [48, 50], "kidnei": 5, "kiela": 7, "kielbasa": 14, "kieran": [5, 14], "kijima": 49, "kilian": 49, "killer": [2, 9, 25], "kilo": 24, "kilobas": 23, "kim": [1, 7, 9, 11, 15, 17, 23, 24, 25, 26, 27, 28, 34, 40, 48, 49], "kimberli": [24, 37], "kin": 7, "kind": [1, 2, 3, 7, 11, 21, 47, 49], "kindli": 30, "kinet": [49, 51], "king": [5, 36, 50, 51], "kingsford": 23, "kinzler": 49, "kip": 14, "kir": 2, "kirschenbaum": 50, "kirschner": [24, 50], "kirsi": 23, "kirsten": 49, "kirsti": 50, "kirston": [2, 24], "kiselev": [7, 25], "kiseliova": 50, "kit": [9, 24], "kitti": [13, 23], "kivioja": 24, "kiwisolv": [1, 7, 15, 21, 25], "kiya": 50, "kj": 50, "kkm": 49, "kkw": 49, "kl": [15, 27, 38], "klaeger": 50, "klappenbach": 48, "klauk": 49, "klein": [7, 11, 17, 19, 23, 24, 27, 28, 34, 37, 40, 41, 48, 49, 50, 51], "kleinstein": 1, "klenerman": 24, "kleshchevnikov": [7, 36], "klf1": 12, "klf4": [5, 12, 19], "klggalqak": 4, "klhl17": [3, 7], "klhl36": 8, "klimovskaia": 16, "klingel": 36, "klinger": [4, 15], "kloiber": 17, "klrb1": [12, 27], "klrc2": 12, "klrd1": [25, 27], "klrf1": 12, "klrg1": [5, 12, 45], "klrk1": [12, 27], "kluger": [13, 25], "kmean": 44, "knee": 23, "knight": 25, "knitr_1": [8, 25], "knn": [5, 6, 7, 8, 11, 13, 34, 36, 37], "knn_model": 5, "knn_transform": 5, "knock": 16, "knockdown": 26, "knockout": [14, 16, 26], "knocktf": 26, "know": [1, 5, 7, 15, 17, 21, 23, 24, 26, 31, 34, 36, 38, 50], "knowledg": [5, 7, 15, 17, 19, 21, 22, 24, 26, 27, 30, 50, 51], "known": [1, 2, 3, 4, 5, 6, 7, 13, 14, 15, 16, 18, 19, 23, 24, 25, 26, 27, 30, 33, 34, 37, 38, 39, 43, 48, 49, 50, 51], "known_hash": [44, 45, 46, 47, 48], "ko": [4, 16, 26], "kobak": 31, "kobayashi": [5, 7], "koch": 24, "koen": 14, "koga": 34, "kohlwai": 8, "kok": 7, "kole": [5, 7, 50], "komech": 4, "kon": 25, "koneva": 4, "kong": [5, 49], "konno": 49, "konrad": 36, "konstantin": 17, "koopman": 24, "korbel": 14, "kori": 36, "korkut": 16, "korotkevich": 15, "korsunski": [5, 7, 44], "koryu": 7, "kostka": 23, "kothap": 25, "kotrov": 23, "kotton": 49, "kou": 15, "koulena": 49, "kovaltsuk": 4, "kowalczyk": [24, 50], "kowalski": 27, "kozlov": 14, "kp": 49, "kptracer": 49, "kptracer_adata": 49, "kr": [17, 26], "kra": 49, "kram": [3, 4], "kramann": 36, "krammer": [17, 26, 50], "krasnow": [5, 7, 50], "krau": 2, "krauthgam": 51, "kren": 50, "kretzmer": 49, "kri": [1, 2], "krishnaswami": [7, 11, 13, 16, 24, 27, 28, 34, 48], "kristensen": 14, "kristian": [17, 26], "kristina": 23, "kristj": [23, 51], "kristof": [8, 9], "kristoph": [27, 28, 48, 50], "kroll": 24, "kropski": [5, 7, 50], "krostag": 49, "krzysztof": [2, 7, 50], "ks19": 1, "kst": 25, "kt": 49, "kth_distanc": 13, "ku": 49, "kuan": 25, "kuang": 37, "kuchel": 11, "kucinski": 50, "kuemmerl": [19, 37, 40, 41], "kuhn": [2, 17], "kulkarni": 9, "kullback": 38, "kumar": [4, 7, 11, 15, 17, 27, 28, 34, 48, 49], "kun": [5, 15, 23, 36, 38], "kunal": 24, "kunkel": [17, 26], "kuo": [5, 7, 14, 49], "kupffer": 5, "kupp": 36, "kuppasani": [7, 11, 27, 28, 34, 48], "kuppe_snrna_human_heart_2022_control": 36, "kuppe_visium_human_heart_2022_control": 36, "kursaw": 11, "kurth": [17, 26], "kushnir": 25, "kw": 21, "kwak": 49, "kwarg": [7, 11, 13, 27, 28, 36], "kwon": [24, 49], "kxj037": 7, "kxx053": 14, "kyle": [5, 7, 37, 41, 50], "kyung": [23, 24, 49, 51], "kyungsoo": 26, "kyungta": [7, 50], "k\u00fchl": 40, "l": [2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 30, 33, 37, 38, 39, 40, 41, 47, 48, 49, 50, 51], "l1": 16, "l2": 16, "l6": 49, "l9": 49, "l_": 36, "la": [14, 16, 23, 24, 50, 51], "laak": 36, "lab": [2, 7, 8, 24, 26, 50], "labalett": 24, "label": [1, 2, 3, 5, 6, 8, 11, 14, 15, 16, 17, 18, 23, 24, 25, 26, 27, 28, 36, 37, 38, 42, 49, 50], "label_col": 16, "label_color": 14, "label_fonts": [1, 4], "label_kei": [5, 7, 28], "labeling_0": [8, 27], "labels_kei": [7, 16, 36], "labor": [5, 24], "laboratori": 24, "labori": [5, 18], "lacar": 24, "lack": [13, 14, 21, 22, 23, 24, 25, 29, 43, 49, 51], "laddach": 7, "lafyati": [5, 7, 50], "lafzi": 24, "lai": [5, 37], "lake": 15, "lakshminarasimha": [5, 7, 50], "laleh": [7, 50, 51], "lam": [23, 24, 37], "lamar": [5, 14, 19, 27, 28], "lambda": [3, 4, 11, 15, 19, 23, 25, 49, 51], "lambda_1": 13, "lambiott": 6, "lamin": [9, 50], "lamindb": [49, 50, 51], "lan": [15, 23, 24], "lanata": [14, 15, 16, 25], "lanc": [5, 7, 9, 10, 11, 27, 28, 30, 34, 48, 50], "lander": 15, "landmark": 49, "landscap": [1, 2, 3, 16, 17, 23, 24, 25, 30, 34, 39, 48, 49, 50, 51], "landthal": [17, 26], "lane": [18, 23], "lang": [3, 50, 51], "langefeld": 14, "langevin": [7, 38], "languag": [1, 7, 19], "lap3": 25, "lapack": [8, 15, 25, 27, 28], "lappli": 15, "lar": [50, 51], "laraib": [23, 51], "larbi": 17, "lareau": [8, 9, 11, 48, 50], "larg": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 30, 36, 41, 45, 46, 48, 49, 50], "larger": [2, 3, 5, 7, 11, 13, 14, 15, 16, 21, 23, 33, 34, 36, 49, 50], "largest": [3, 4, 31], "larsen": 24, "larsson": 7, "laser": 2, "laserson": 1, "lasken": 24, "lassauzai": 51, "last": [1, 2, 4, 8, 11, 13, 16, 23, 27, 28, 32, 36, 38], "lastli": [11, 34], "late": [3, 5], "latent": [3, 4, 5, 7, 8, 13, 14, 16, 18, 19, 23, 27, 28, 33, 36, 51], "latent_distribut": 7, "latent_ref": 27, "later": [2, 4, 5, 7, 8, 11, 14, 15, 16, 18, 19, 21, 23, 24, 25, 27, 28, 31, 34, 37, 38, 48, 49, 50, 51], "later_1": [8, 25, 27, 28], "latest": [1, 2, 19, 22, 27, 30], "lathia": 24, "latin": 24, "latter": [4, 11, 23, 25, 34, 38], "lattic": [7, 21], "lattice_0": [8, 15, 25, 27, 28], "latticeextra_0": 25, "lau": [23, 24], "lauffenburg": 15, "lauken": 2, "lauma": 36, "launch": 34, "laur": [5, 7, 17, 26, 50], "laura": [7, 9, 10, 11, 14, 25, 27, 28, 34, 37, 48, 50], "lauren": [5, 14, 15, 16, 23, 25, 48, 51], "laurent": [19, 22], "laurenti": 50, "lauri": 5, "lava_1": 25, "lavin": 36, "law": [14, 15], "lawlor": 11, "lawrenc": [19, 22, 24, 50], "layer": [3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 25, 27, 28, 31, 32, 33, 34, 36, 37, 41, 43, 44, 45, 46, 47, 50, 51], "layout": [1, 15, 23], "layout_method": 1, "lazyev": [7, 21], "lazyeval_0": [8, 25, 27, 28], "lbc": [27, 28], "lbuttnerc": 28, "lc_address": [8, 25, 27, 28], "lc_collat": [8, 25, 27, 28], "lc_ctype": [8, 25, 27, 28], "lc_identif": [8, 25, 27, 28], "lc_measur": [8, 25, 27, 28], "lc_messag": [8, 25, 27, 28], "lc_monetari": [8, 25, 27, 28], "lc_name": [8, 25, 27, 28], "lc_numer": [8, 25, 27, 28], "lc_paper": [8, 25, 27, 28], "lc_telephon": [8, 25, 27, 28], "lc_time": [8, 25, 27, 28], "lck": 43, "lcm": 2, "lcount_cutoff_upp": 11, "lda": 16, "lda_1": 8, "lder": 14, "le": [23, 25, 50], "lead": [2, 4, 6, 8, 9, 11, 13, 15, 16, 17, 18, 23, 24, 25, 26, 28, 30, 33, 34, 36, 48, 49], "leaf": [13, 49], "leak": 34, "leander": [5, 7, 50, 51], "leandro": 51, "learn": [3, 4, 5, 6, 7, 13, 15, 16, 17, 19, 21, 22, 23, 25, 26, 27, 28, 30, 36, 38, 49, 50, 51], "learner": 30, "learnt": [19, 36], "least": [1, 5, 7, 11, 13, 16, 23, 25, 32, 34, 46, 50, 51], "leav": [13, 34, 46, 49], "leaves_in_subtre": 49, "lebofski": 8, "lebrigand": 24, "lectin": 2, "led": 23, "lee": [2, 5, 7, 14, 15, 17, 19, 24, 25, 26, 27, 28, 37, 41, 49, 50], "leeper": 49, "lef1": [5, 12, 26], "lefebvr": 6, "left": [1, 3, 7, 8, 11, 13, 16, 23, 28, 33, 41, 42, 46, 49], "legaci": 21, "legacy_api_wrap": [1, 25], "legend": [1, 5, 13, 16, 28, 49], "legend_fontoutlin": 1, "legend_fonts": [1, 5, 36], "legend_loc": [1, 5, 6, 13, 19, 36], "legibl": 5, "lei": [31, 37], "leibi": 25, "leibler": 38, "leiden": [2, 3, 5, 6, 7, 10, 19, 21, 33, 34, 36, 37, 38, 43, 50], "leiden_0": [25, 27, 28], "leiden_1": 5, "leiden_2": 5, "leiden_color": [21, 37, 38, 43], "leiden_res0_25": 6, "leiden_res0_5": 6, "leiden_res1": 6, "leiden_wnn": 21, "leidenalg": [1, 5, 6, 7, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "leif": [7, 17, 26, 48, 50], "leighton": 23, "leimk": 25, "lein": 24, "lelieveldt": 14, "lem": 2, "len": [1, 2, 3, 4, 5, 7, 14, 15, 26, 28, 38, 44, 49], "lena": [13, 16, 23], "lenail": 16, "lenei": 7, "length": [1, 2, 3, 4, 8, 11, 15, 18, 19, 21, 23, 25, 27, 28, 37, 45, 47, 49], "lenient": 34, "lenka": [14, 15, 16, 25], "lennart": 31, "lenno": 50, "lentivir": 49, "leo": 49, "leon": [4, 5, 36, 38, 49], "leonard": 16, "leonardo": 13, "leonhardt": 24, "leoni": [5, 7, 50], "leonid": [24, 49, 50], "ler": [17, 26], "leroi": [5, 7, 24], "leshchin": 49, "less": [1, 4, 5, 6, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 21, 23, 26, 29, 31, 33, 34, 38, 47, 48, 49, 50], "lesser": 4, "lesson": 7, "let": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 19, 21, 25, 27, 36, 37, 38, 40, 41, 42, 43, 47, 48, 49], "letter": [1, 21], "levchenko": 25, "level": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 16, 18, 21, 23, 24, 25, 26, 28, 30, 32, 36, 43, 46, 47, 48, 49, 50], "levels_orig": 13, "levenshtein": [1, 18], "leverag": [5, 6, 11, 16, 18, 23, 25, 33, 36, 37, 38, 41, 49], "levi": [19, 22, 24], "levin": [14, 16, 23, 24, 50], "levinson": 36, "lewi": 25, "lez": [8, 15, 26], "lf": [21, 26, 28], "lfc": 14, "lfc_col": 14, "lfcs_thr": 25, "lg": 49, "lgals9": 25, "lgr_0": 8, "li": [3, 5, 7, 9, 13, 14, 15, 17, 22, 23, 24, 25, 26, 34, 36, 37, 38, 41, 48, 49, 50], "liam": [7, 50], "liana_r": 25, "liang": [4, 37, 49], "liangchen": 39, "liao": [15, 36, 37], "lib": [1, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 17, 19, 21, 25, 27, 28, 34, 36, 37, 41, 50], "lib_siz": [14, 15, 25], "liberzon": 15, "libgio": 13, "libo": 49, "libopenblasp": [8, 15, 25, 27, 28], "libpath": [10, 11], "librari": [1, 3, 7, 8, 9, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 32, 33, 34, 36, 37, 40, 41, 48, 49], "library_kei": 36, "library_typ": 23, "lickert": [7, 11, 27, 28, 34, 48, 51], "lidschreib": [50, 51], "lie": 24, "liek": 5, "liesbeth": [8, 9], "life": [18, 19, 30, 51], "lifecycl": [7, 21], "lifecycle_1": [8, 25, 27, 28], "lifetim": 1, "ligand": 16, "ligand_act": 25, "ligand_complex": 25, "ligand_mean": 25, "ligand_oi": 25, "ligand_prop": 25, "ligand_target_df": 25, "ligand_target_matrix": 25, "ligand_target_matrix_nsga2r_fin": 25, "ligand_target_potenti": 25, "ligat": [18, 24], "light": [2, 4, 49], "lightn": [16, 36], "lightning_fabr": 36, "lightningdeprecationwarn": [7, 27, 28], "lightweight": 23, "lihua": [4, 25], "lijuan": 7, "like": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "likelihood": [8, 13, 14, 23, 28, 49, 51], "likewis": [1, 23], "lili": 25, "lilrb1": 27, "lilrb2": [8, 25], "lim": [5, 7, 50], "limit": [2, 3, 4, 5, 7, 8, 9, 13, 14, 15, 21, 22, 23, 24, 34, 36, 37, 38, 39, 45, 49, 50, 51], "limma": [14, 25], "limma_3": [15, 25], "lin": [7, 13, 25, 36, 38, 43, 49], "lina": [24, 50], "linag": [12, 25], "linc01128": 7, "linc01409": 7, "linda": [17, 24, 26, 36], "lindeman": 2, "lindenbaum": 13, "lindsai": 22, "line": [1, 2, 3, 4, 7, 8, 11, 15, 16, 18, 23, 41, 51], "lineag": [1, 2, 3, 4, 5, 13, 15, 18, 25, 50, 51], "lineage_group": 49, "lineage_util": 49, "lineagegrp": 49, "lineageot": 49, "linear": [1, 2, 3, 4, 5, 11, 13, 14, 15, 17, 24, 28, 31, 33, 34, 36, 50, 51], "linestyl": 11, "linewidth": 13, "lingjuan": 49, "linh": [5, 7, 50], "linhui": 25, "link": [1, 3, 4, 5, 6, 7, 8, 9, 18, 21, 25, 26, 39, 41, 44, 49], "linkag": [1, 4], "linker": 24, "linkinghub": 25, "linnarsson": [23, 24, 50, 51], "linslei": 14, "linton": 49, "linu": 37, "linux": [1, 8, 25, 27, 28], "linzhao": [36, 38], "lior": [7, 23, 51], "lipinski": 38, "liposaccharid": 2, "liquid": 2, "liqun": 37, "lira": [2, 7, 50], "lisa": [3, 4, 5, 7, 50], "lisbi": 37, "lisgo": 50, "list": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "listdata": 17, "listenv": [7, 21], "listenv_0": [25, 27, 28], "litchfield": 49, "liter": 18, "literatur": [5, 13, 23, 49], "litinetskaya": [13, 14, 15, 21, 27, 28], "littl": [11, 16, 24, 28, 49], "litvi": 7, "litzenburg": 50, "liu": [3, 4, 5, 7, 15, 17, 23, 24, 25, 26, 36, 37, 38, 39, 48, 49, 50, 51], "live": [1, 18, 24, 30, 50], "liver": 38, "livnat": 16, "liwen": 15, "lixia": 48, "ljz20": 49, "lk": 1, "lken": 50, "ll": [5, 15, 17, 23, 40, 43, 49, 51], "ller": [7, 11, 13, 15, 17, 23, 26, 27, 28, 34, 48], "llner": 50, "lloyd": 50, "llquist": 50, "llr": 41, "llvmlite": [1, 7, 15, 21, 25], "lm": 15, "lme4": 14, "lmtest": [7, 21], "lmtest_0": [25, 27, 28], "lmweber": 22, "ln": 50, "lncrna": 18, "lo": [13, 23, 43], "load": [1, 3, 4, 6, 7, 9, 11, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 32, 33, 34, 36, 37, 38, 40, 41], "load_ext": [7, 11, 14, 15, 17, 21, 25, 27, 28, 32, 33, 34], "load_fri": 23, "load_model": 3, "load_query_data": [5, 27], "loaded_data": 16, "loader": [16, 21], "loadfri": 23, "loadh5seurat": 21, "lobo": 14, "loc": [1, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 38, 45, 46, 48, 49], "local": [1, 5, 7, 8, 9, 13, 15, 23, 25, 26, 27, 28, 31, 36, 41], "local_rank": [5, 27, 28, 36], "locat": [1, 2, 5, 7, 11, 18, 19, 23, 24, 26, 36, 37, 38, 39, 41, 49], "locfit_1": 15, "loci": [1, 18, 23], "locu": [1, 2, 18, 23], "locus_statu": 1, "locus_vdj": 1, "locus_vj": 1, "loeb": [23, 24], "loess": 14, "log": [1, 3, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 25, 27, 28, 32, 33, 34, 36, 37, 41, 49, 50], "log10": [11, 13, 15, 26, 36], "log10p": 8, "log1p": [3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 32, 33, 34, 37, 50, 51], "log1p_mean_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_n_genes_by_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_norm": [31, 33], "log1p_total_count": [21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "log1p_total_counts_hb": 34, "log1p_total_counts_mt": [34, 37], "log1p_total_counts_ribo": 34, "log1ppf": 6, "log2": [13, 14], "log2fc": 25, "log_": 15, "log_2": 15, "log_every_n_step": 36, "log_fold_chang": 14, "log_lib_s": 14, "log_norm_x": 15, "log_scal": 48, "log_total_fragment_count": 11, "log_transform": 19, "logarithm": [14, 31, 34, 51], "logcount": [7, 13, 21], "logcpm": [13, 14, 15], "logcpm_fl": 15, "logcpm_fle_pca": 15, "logfc": [13, 14, 15, 25], "logfold": 14, "logfoldchang": [14, 43], "logger": [7, 14, 27, 28, 32, 33, 34], "logic": [1, 25], "logist": 13, "logistic_regression_classifi": 16, "logo": 1, "logo_motif": 1, "logq": 14, "logratio": 13, "loh": [7, 44], "lolita": 7, "lollipop": 16, "lomakin": 36, "londo": 50, "london": [2, 42], "long": [2, 3, 4, 8, 9, 11, 13, 17, 19, 21, 23, 24, 25, 37, 49, 51], "longer": [3, 6, 7, 8, 15, 19, 24, 51], "longfei": [36, 38], "longlong": 4, "longqi": 37, "lonrf1": 8, "looger": 24, "look": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "lookup": 25, "loom": 26, "loom_path": 26, "loom_path_output": 26, "loomi": [16, 47, 48, 50], "loompi": 26, "loop": [5, 14, 27, 30, 36], "loos": 49, "lope": 25, "lopez": [5, 7, 16, 23, 25, 27, 28, 36, 38, 44, 49, 50], "loren": 24, "lorenzi": 25, "lorenzo": [17, 23, 26, 38], "lorrain": 5, "lose": [31, 34, 39], "loss": [1, 7, 9, 13, 23, 24, 27, 28, 36], "loss_coef": 27, "loss_weights_kl": 3, "loss_weights_tcr": 3, "lost": [2, 18, 44], "lot": [5, 21], "lotfollahi": [3, 5, 7, 16, 19, 37, 40, 41, 50, 51], "loui": [19, 37, 40, 41], "louie": 2, "louis": [1, 7, 11, 27, 28, 34, 48, 50], "louisa": 36, "loup": [6, 23], "louvain": [1, 5, 6, 7, 21, 37, 50], "louzoun": 4, "love": [14, 19, 22, 23], "loveless": 49, "low": [1, 4, 5, 7, 9, 11, 13, 14, 16, 17, 18, 23, 24, 25, 26, 28, 29, 31, 33, 37, 38, 39, 40, 43, 45, 47, 48, 50, 51], "low_memori": [3, 49], "low_qc": 49, "lower": [1, 3, 6, 7, 13, 14, 16, 23, 24, 26, 31, 34, 36, 38, 46, 48, 49, 50, 51], "lowest": [3, 7, 24, 25, 26, 31], "lowli": [5, 16, 25], "lowqval_d": 14, "loyal": 51, "lp": 26, "lppantnsf": 4, "lppvytnsf": 4, "lpsyaafat": 4, "lqab023": 2, "lqaenvtgl": 4, "lr": [3, 36], "lr_gmean": 25, "lr_logfc": 25, "lr_mean": 25, "lr_network": 25, "lr_network_human_21122021": 25, "lr_prob": 25, "lrc": 49, "lrs_to_keep": 25, "lrschedul": 27, "lrscore": 25, "lsi": [10, 19], "lsi_1": 10, "lsw22": 25, "lt": [8, 10, 25], "ltdemiaqi": 4, "ltj": 49, "lu": [4, 7, 16, 23, 37, 38, 43, 51], "lu_merfish_mouse_fetal_liver_2021": 38, "lu_scrna_mouse_fetal_liver_2021": 38, "lubeck": 29, "lubridate_1": 25, "luc": [11, 32, 33, 34], "luca": [11, 14, 17, 24, 40], "lucero": 9, "lucian": 17, "luciani": [2, 24], "luckili": 51, "ludmil": 49, "ludvig": [2, 7, 36], "ludwig": [7, 21, 22, 48, 50], "luecken": [5, 7, 11, 14, 22, 27, 28, 34, 48, 50], "lui": [16, 24, 49], "luisa": 13, "luka": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "lukassen": [7, 40], "lukasz": 14, "luke": [5, 7, 9, 21, 23, 30, 34, 50], "luli": 36, "luminesc": 24, "lun": [7, 11, 13, 15, 22, 23], "luna": 16, "lundberg": 39, "lundeberg": [5, 36, 41], "lung": [5, 7, 13, 50], "lungmap": 7, "luo": [4, 7, 15, 24, 48, 50], "luoma": 16, "lupu": [14, 16, 25], "lusser": 50, "lustr": [10, 27, 28], "luyi": 23, "luz": [15, 23, 24, 25, 26], "lvarez": 24, "lx2xownlrhz3us8496tyu9c4dgade814": 23, "lxml": 1, "ly": 24, "lymph": [5, 7, 12], "lymphocyt": [1, 2, 24], "lymphoid": [5, 15, 36], "lyn": [5, 12], "lynch": 7, "lyndsai": 23, "lysi": [24, 34], "lyz": [5, 12], "l\u00fccken": [7, 22], "m": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 34, 36, 37, 38, 40, 41, 47, 48, 49, 50, 51], "m0": 26, "m1": 23, "m2": 23, "m_": 38, "m_j": 38, "ma": [4, 8, 13, 14, 15, 17, 37, 38, 41], "maarten": 5, "maatz": 7, "maayan": 17, "mac": [2, 5], "macadlo": 5, "macaqu": 1, "macaulai": [24, 30], "macdonald": [19, 22], "machin": [3, 4, 5, 6, 7, 16, 19, 23, 24, 26, 30], "machineri": [24, 26], "machleidt": [17, 26], "macklaim": 13, "maclean": 25, "macnair": 11, "maco": [7, 15, 21], "macosko": [23, 24, 36, 38], "macqueen": 50, "macrophag": 5, "mad": 34, "madad": 27, "maddi": [5, 14, 19, 27, 28], "made": [0, 5, 15, 16, 21, 23, 24, 34, 47, 49], "madelin": 27, "madhura": 49, "madisen": 24, "madissoon": [5, 7, 50], "madrid": 42, "maduro": [7, 49], "mae": 21, "magalh\u00e3": 17, "magda": [25, 50], "magic": [3, 11, 21], "magic_cpm": 21, "magic_imputed_data": 50, "magma": 36, "magnet": 2, "magnitud": [14, 25, 49], "magnitude_rank": 25, "magnon": 24, "magnusson": 14, "magrittr": [7, 21], "magrittr_2": [8, 25, 27, 28], "magrud": 17, "mahajan": 4, "mahbubani": 5, "mahdi": [19, 29], "mahfouz": [5, 14, 24, 38], "mahmoud": [15, 26], "mai": [2, 3, 4, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 41, 43, 45, 48, 50, 51], "main": [3, 7, 8, 9, 13, 15, 17, 19, 21, 23, 25, 26, 34, 36, 37, 41, 48, 49], "mainexpnam": [7, 21], "mainli": [1, 2, 3, 4, 15, 17, 24, 36, 51], "maintain": [0, 6, 17, 18, 21, 24, 44], "maintenance_cocain": 16, "mair": [47, 48], "mait": [5, 12], "major": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 21, 23, 24, 25, 26, 28, 43, 49], "major_label": 36, "major_labl": 36, "majority_vot": 5, "majorli": 26, "makarov": 16, "make": [1, 4, 5, 7, 10, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 27, 28, 29, 31, 33, 34, 36, 38, 41, 43, 44, 47, 48, 49], "make_nhood": 13, "makecontrast": [14, 15], "makesummarizedexperimentfromdatafram": 8, "maksim": 25, "malat1": [14, 19], "male": 2, "mali": 49, "malik": [23, 51], "maliskova": [14, 15, 16, 25], "malka": 15, "malt": [5, 7, 11, 14, 22, 23, 27, 28, 34, 48, 50], "malu": 16, "mamanova": [2, 5, 7, 50], "mambaforg": 11, "mammalian": [23, 49], "mamoru": 49, "manag": 21, "manakongtreecheep": 7, "manasa": 49, "mancilla": 16, "mandeep": [2, 24], "mandoiu": 14, "mangul": 17, "mani": [0, 1, 2, 4, 5, 6, 8, 9, 11, 13, 14, 16, 17, 19, 21, 23, 24, 25, 26, 29, 32, 33, 34, 36, 39, 47, 48, 49, 50, 51], "manifest": 30, "manifold": [25, 31, 50, 51], "maniou": 23, "manipul": [8, 19, 49], "mann": 29, "manner": [2, 4, 7, 15, 24, 25], "manno": [14, 16, 23, 24, 50, 51], "manu": [5, 7, 15, 50, 51], "manual": [7, 11, 13, 14, 15, 21, 23, 24, 29, 34], "manual_celltype_annot": 5, "manufactur": 24, "manuscript": 25, "manz": 1, "mao": 23, "map": [2, 3, 4, 6, 7, 8, 9, 11, 15, 16, 17, 18, 24, 25, 26, 28, 42, 43, 49, 50, 51], "map_cells_to_spac": 38, "mapk": 15, "mapping_dict": 3, "mapqueri": 27, "maptool": 21, "mar": [2, 5, 9, 16, 24, 25, 27, 28, 37, 50], "mara": 50, "marc": [7, 19, 22, 24, 36, 37, 50], "marcel": [5, 14, 23, 38], "march": [6, 7, 9, 11, 13, 34, 39, 41, 50, 51], "marcin": [49, 50], "marco": [5, 7, 16, 23, 49], "marco2022optim": 23, "marcu": 23, "maren": [5, 7, 50], "mare\u010dkov\u00e1": 25, "margaret": [23, 49], "margarita": 9, "margin": [27, 42], "mari": [1, 5, 7, 25, 48, 50, 51], "maria": [1, 14, 17, 23, 24, 26, 49, 50, 51], "mariam": 49, "mariana": 50, "mariann": 43, "mariano": [7, 28], "mariek": 51, "marijn": [5, 7, 50], "marin": [15, 26], "marini": 22, "marion": 7, "marioni": [7, 13, 14, 15, 23, 28, 50, 51], "marionilab": [13, 33], "marisa": 50, "marissa": 4, "mariu": [50, 51], "marjaneh": [19, 29], "marjanov": 24, "mark": [1, 4, 5, 6, 7, 11, 13, 14, 16, 17, 23, 24, 26, 32, 33, 34, 47, 49, 50, 51], "markedli": 23, "marker": [2, 3, 7, 8, 11, 13, 14, 15, 17, 18, 24, 28, 38, 41, 43, 44, 45, 48, 49], "marker_gen": [5, 8, 12], "marker_genes_in_data": 5, "marker_prot": 12, "markers_found": 5, "markert": 1, "market": 24, "marko": [5, 7, 50], "markov": [5, 7, 37, 49, 50], "marku": [1, 4, 17, 26, 29], "markupsaf": [1, 7, 15, 21, 25], "marleen": 14, "marlen": [2, 19], "marlon": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "marot": 51, "marouf": 17, "marquett": 5, "marriag": 49, "marrow": [2, 5, 7, 28, 34, 48], "marschal": 14, "marshal": 49, "mart": 49, "marta": [5, 24, 51], "marten": [9, 10, 11, 28], "martersteck": [23, 24], "martha": 24, "martijn": [5, 7, 24, 50], "martin": [1, 5, 7, 9, 14, 17, 19, 22, 24, 25, 26, 32, 47, 49], "martina": [13, 15], "martincorena": 49, "martinez": [3, 49], "martino": 25, "martowicz": 13, "martuza": 49, "marvin": [29, 50], "masahiro": [1, 2, 5, 7, 23, 50], "masanao": [14, 34], "masatoshi": 49, "mascibroda": 16, "mask": [1, 7, 11, 19, 24, 26, 27, 32], "mask_dropout": 26, "mason": 49, "masoud": 24, "masqueli": [23, 24], "mass": [6, 7, 13, 21, 29], "mass_7": [8, 25, 27, 28], "massiv": [0, 16, 23, 24, 29, 39, 48, 50, 51], "mast": [5, 14, 36], "mast_cd14_monocyt": 14, "master": [8, 23, 25, 26, 49], "masuyama": 49, "mat": [8, 25], "match": [2, 5, 7, 8, 10, 11, 15, 16, 17, 19, 21, 23, 24, 26, 27, 36, 38], "match_sequ": 4, "matching_row": 4, "matching_sequ": 4, "matej": 51, "materi": [18, 23, 24, 30], "mateu": 13, "mateusz": 1, "math": 13, "mathbb": 38, "mathbf": 38, "mathemat": [15, 50], "mather": 50, "mathew": 15, "mathia": [24, 37], "mathild": 49, "mathop": 41, "mathsemicolon": 50, "matia": 23, "matin": 5, "matplotlib": [1, 4, 5, 7, 11, 13, 14, 15, 19, 21, 25, 26, 28, 32, 33, 36, 38, 49], "matplotlib_inlin": [1, 7, 15, 25], "matric": [3, 4, 8, 14, 15, 17, 18, 21, 23, 28, 34, 38, 45, 49], "matrix": [1, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 40, 49, 51], "matrix_1": [8, 15, 25, 27, 28], "matrixgener": [7, 21], "matrixgenerics_1": [8, 15, 27, 28], "matrixplot": 26, "matrixstat": [7, 21], "matrixstats_0": [8, 15, 25, 27, 28], "matsen": 49, "matson": [14, 16], "matt": [5, 23], "matteo": 17, "matter": [7, 14, 49], "matthew": [2, 4, 7, 14, 15, 16, 19, 23, 24, 25, 29, 34, 37, 47, 49], "matthia": [17, 24, 26, 29], "matthieu": [14, 16, 51], "matur": [1, 2, 4, 13, 18, 50, 51], "mauck": [5, 7, 14, 16, 19, 27, 28], "maunder": 50, "mauric": 36, "mauricio": 5, "maurizio": [7, 11, 27, 28, 34, 48], "max": [2, 3, 5, 7, 8, 14, 16, 17, 23, 26, 27, 49, 50], "max_col": 1, "max_color_quantil": 36, "max_count": 48, "max_delta": 41, "max_epoch": [5, 7, 13, 16, 27, 28, 36], "max_epochs_scanvi": 7, "max_epochs_scvi": [7, 13], "max_gen": 19, "max_i": 38, "max_it": 3, "max_ll": 41, "max_ll_nul": 41, "max_mean": 19, "max_miss": 1, "max_mu_hat": 41, "max_out_group_fract": 5, "max_ribbon": 1, "max_s2_t_hat": 41, "max_seg": 1, "max_siz": 1, "maxcutoff": 8, "maxim": [3, 7, 15, 16, 17, 23, 38, 49, 51], "maximilian": [3, 7, 17], "maximum": [1, 5, 8, 9, 11, 15, 16, 36, 48, 49], "maximum_percent_uncut_in_cel": 49, "maxit": 11, "maxwel": [24, 37], "mayr": [3, 5, 7, 50], "mayu": [48, 50], "mazuti": [24, 50], "mazzeo": 25, "mb": [2, 4, 24, 49], "mbano": 7, "mbiguou": 23, "mbp": 41, "mc9nr": 26, "mcadam": 7, "mcalpin": 5, "mccarrol": [23, 24], "mccarthi": [5, 14, 15, 16, 24, 25], "mcclanahan": 48, "mcconeghi": 23, "mcconnel": 24, "mccorrison": 24, "mcdavid": 14, "mcdermott": [23, 24], "mcdonald": 50, "mcelrath": [5, 14, 19, 27, 28], "mcfalin": 16, "mcfarland": [23, 24], "mcgaughei": 7, "mcgeever": [7, 11, 27, 28, 34, 48], "mcginni": [11, 23], "mcgranahan": 49, "mcgrath": 50, "mchardi": 14, "mckenna": 49, "mcmc": 49, "mcmurrough": 13, "mcmv": 4, "mcnamara": 3, "mcpa": 4, "mcpherson": 5, "mcq": 42, "md": [6, 14, 19, 48], "md5": 19, "mdata": [11, 13, 16, 19, 21, 28, 44, 45, 46, 47, 48], "mdata_multiom": 28, "mdata_r": 19, "mdata_raw": [47, 48], "mdata_sub": 19, "mdc": 17, "mean": [1, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 41, 47, 49, 50, 51], "mean_accuraci": 16, "mean_auc": 16, "mean_auc_by_cell_typ": 26, "mean_auc_by_cell_type_top_n": 26, "mean_augur_scor": 16, "mean_augur_score1": 16, "mean_augur_score2": 16, "mean_count": [11, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "mean_f1": 16, "mean_n_cel": 13, "mean_precis": 16, "mean_recal": 16, "meaning": [5, 7, 9, 11, 15, 17, 23, 25, 32], "means_per_cluster_mu_fg": 36, "means_per_cluster_mu_fg_": 36, "meanscor": 8, "meant": [25, 30], "measur": [1, 2, 3, 5, 7, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 38, 41, 43, 47, 48, 49, 50, 51], "mebocost": 25, "mechan": [1, 2, 6, 9, 14, 16, 17, 18, 24, 30], "mechanist": 8, "mecom": [5, 12], "median": [5, 13, 33, 34, 48], "median_abs_devi": [34, 48], "mediat": [8, 16, 25], "medic": 1, "medicin": [1, 2, 3, 5, 7, 15, 49, 50], "medina": 51, "medium": [4, 6], "meena": [14, 15, 16, 25], "meet": 49, "mega": [7, 24, 50], "megakaryocyt": [5, 14, 16, 17, 25], "megason": 50, "meghan": 50, "mehlman": 7, "mehmood": 14, "mei": [5, 7, 13, 17, 22, 25, 26, 37, 50], "meier": 29, "meifang": [36, 38], "meirel": 15, "meisel": [17, 26], "meixid": 11, "mejia": 49, "mekonen": [7, 11, 27, 28, 34, 48], "melani": [17, 24, 26], "melania": 51, "meld": 13, "melgarejo": [7, 11, 27, 28, 34, 48], "melissa": [23, 24], "melm": 16, "melst": [23, 51], "melt": [2, 13], "melton": 17, "melvin": 29, "member": [1, 40], "membership": 15, "membran": [2, 18, 24, 25, 34, 43], "memoise_2": 8, "memori": [1, 2, 5, 11, 17, 19, 23, 26, 34, 50, 51], "memp": 5, "mend": 50, "menden": 17, "meng": [15, 25, 26, 38], "mengnan": 37, "mengzh": 37, "menon": [5, 24, 49], "mention": [1, 4, 6, 7, 9, 13, 14, 15, 19, 21, 23, 24, 25, 26, 31, 32, 34, 37, 48], "menzel": 36, "mer": [1, 4, 17, 26], "merav": 36, "merchant": 14, "mere": 5, "mereu": [15, 24, 36], "merfish": [37, 38, 39], "merg": [1, 3, 5, 7, 8, 11, 14, 19, 27, 28], "merge_with_ir": 3, "meritxel": 17, "mesenchym": 15, "meshal": [3, 5, 7, 50, 51], "mesirov": 15, "messag": [1, 8, 10, 11, 15, 21, 25, 27, 28, 50], "messeng": [18, 51], "met": 51, "meta": [7, 11, 21, 34, 49], "meta_data": 49, "meta_item": 49, "metabol": [15, 24, 25, 50], "metabolit": 25, "metadata": [1, 3, 7, 10, 11, 14, 17, 18, 21, 23, 27, 34, 38, 49], "metastasi": 49, "metastat": 49, "metfamili": 49, "method": [1, 2, 3, 4, 5, 6, 8, 9, 11, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 47, 48, 50, 51], "methodolog": [13, 14, 15, 43], "methodologi": [1, 14, 23, 49], "methodss3_1": 8, "methyl": [9, 18], "meticul": 49, "metric": [1, 3, 5, 7, 8, 16, 18, 19, 23, 26, 27, 29, 34, 36, 38, 48], "metrics_bbknn": 7, "metrics_fast": 7, "metrics_hvg": 7, "metrics_mofa": 28, "metrics_sc": 7, "metrics_scanvi": 7, "metrics_scvi": 7, "metrics_seurat": 7, "metrics_totalvi": 28, "metrics_wnn": 28, "meyer": [5, 7, 50], "meysman": 2, "mfg": 49, "mftg22": 28, "mg19": 49, "mgat4a": 8, "mgcv": 7, "mgcv_1": 27, "mh8919227": 2, "mh8919326": 2, "mh8919329": 2, "mh9143270": 2, "mh9143270_contig_1": 2, "mh9143270_contig_2": 2, "mh9143274": 2, "mh9143275": 3, "mh9143324": 2, "mh9143373": 2, "mh9143420": 2, "mh9143423": 2, "mh9143424": 2, "mh9179824": 2, "mhc": [2, 4], "mhci": 4, "mi": [14, 16], "mia": 49, "miao": [7, 9, 23, 38], "mice": [1, 4, 13, 16], "mich": 49, "micha": 25, "michael": [1, 2, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 34, 36, 37, 38, 44, 48, 49, 50], "michaela": [7, 11, 23, 27, 28, 34, 36, 48], "michal": [1, 7, 19, 37, 38, 40, 41, 50, 51], "michel": [5, 7, 14, 15, 16, 17, 25, 49], "michiel": 36, "michielsen": 5, "micro": 24, "microarrai": [7, 14, 15, 17, 24], "microbead": 24, "microbi": [13, 17], "microbiol": 13, "microbiom": [13, 24], "microdissect": 2, "microenviron": [5, 25], "microfila": 24, "microfluid": [2, 23, 49], "microfluifd": 2, "microglia": 16, "micrographia": 24, "microparticl": 24, "microprocessor": 23, "microscop": [1, 2, 24, 49], "microtubul": 24, "microtubular": 24, "microwel": 24, "micura": 50, "mid": [5, 49], "middl": [16, 23, 38], "miescher": 24, "might": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 41, 43, 48, 49], "migrat": [24, 25], "migratori": 5, "miguel": [11, 37], "mika": [36, 50], "mike": 22, "mikhail": 4, "mikkelsen": [23, 24], "milano": 16, "mild": 2, "mile": 34, "millard": [5, 7, 44], "miller": [5, 14, 23, 24], "million": [7, 18, 19, 21, 23, 33, 48], "milo": 13, "milo_composit": 13, "milo_connect": 13, "milo_dist": 13, "milo_results_salmonella": 13, "milor": 13, "milt": 36, "mime": [7, 21], "mime_0": [8, 25, 27, 28], "mimic": [2, 27], "mimit": [5, 14, 16, 19, 27, 28, 48, 50], "min": [1, 7, 8, 13, 14, 15, 16, 17, 23, 24, 25, 33, 34, 42, 49, 51], "min_cel": [1, 4, 7, 14, 16, 19, 25, 34, 37], "min_clade_s": 49, "min_clone_s": 1, "min_count": 50, "min_depth": 49, "min_disp": 19, "min_dist": [19, 36], "min_gen": [14, 19, 25], "min_in_group_fract": 5, "min_intbc_thresh": 49, "min_mean": 19, "min_nod": 4, "min_prop": 25, "min_shared_count": 51, "min_siz": 13, "min_smpl": 25, "mind": [9, 11, 13, 19, 25, 34, 49], "mine": 9, "ming": [15, 37], "mingbo": 36, "minghao": [36, 38], "mingxiang": 14, "mingyao": [37, 41], "miniatur": [23, 24], "miniconda": [4, 7], "miniconda3": [5, 6, 8, 10, 15, 19, 21, 27, 28, 34, 36, 37, 41], "miniforge3": 50, "minim": [6, 7, 11, 13, 16, 17, 23, 24, 26, 49], "minimap2": 23, "minimum": [5, 11, 13, 15, 18, 25, 49, 50], "minimum_intbc_thresh": 49, "minimum_number_of_cel": 49, "minion": 24, "miniui": [7, 21], "miniui_0": [8, 25, 27, 28], "minkina": 49, "minmaxscal": 38, "minnoy": [8, 9], "minor": [9, 38], "minseok": 49, "minut": [3, 7, 8, 9, 13, 25, 26, 41], "minzh": [5, 7, 50], "miqc": 23, "miquel": [23, 25], "mir1302": [10, 11, 19, 36], "miragaia": 24, "mirel": 50, "mireya": [6, 50], "miriam": [17, 26], "mirjana": [25, 50], "mirna": 18, "mirror": 49, "misassign": 24, "misc": [7, 15, 19, 25], "miscal": 23, "miscellan": 21, "misclassifi": 34, "mishael": 26, "misharin": [5, 7, 50], "misinterpret": [1, 34], "miska": 50, "mislead": [13, 15, 16, 23, 25, 51], "mismatch": [23, 24], "misrachi": 7, "miss": [1, 2, 3, 4, 5, 10, 11, 13, 14, 16, 17, 18, 19, 23, 25, 27, 28, 29, 34, 38, 49], "missing_gen": 5, "missing_gene_adata": 5, "missing_hvg": 7, "missing_on_read": 10, "mistak": 49, "mistaken": 15, "mistakenli": 18, "mitch": 4, "mitchel": [17, 49], "miten": 24, "mitic": 49, "mitig": [7, 13, 14, 16, 23, 43, 44], "mito": [16, 17], "mitochondri": [11, 23, 34, 36, 37], "mitochondria": [34, 36], "mittal": 9, "mix": [2, 5, 7, 11, 13, 14, 15, 17, 19, 24, 49], "mixed_cel": 17, "mixscap": 16, "mixscape_class": 16, "mixscape_class_glob": 16, "mixscape_vignett": 16, "mixtur": [2, 3, 5, 16, 17, 24, 28, 36, 49, 51], "mizani": [1, 25], "mk": [5, 7, 12], "mkdir": [5, 23, 51], "mki67": [5, 12], "ml": 3, "ml01": [10, 17, 27, 28], "ml_collect": 7, "mlapi_0": 8, "mlrmbo": 25, "mm10": 8, "mm3": 17, "mm_best": 10, "mmd": 27, "mme": [5, 12], "mmt22": 47, "mnist": 16, "mnp": 5, "mobil": 2, "mock": 21, "mod": [10, 11, 19, 36], "modal": [2, 4, 7, 10, 11, 13, 16, 18, 19, 21, 25, 27, 28, 30, 38, 44, 45, 46, 47, 48, 50], "modality_kei": 13, "modality_length": 27, "modatac": 10, "mode": [1, 3, 16, 19, 23, 24, 26, 28, 38, 41, 51], "model": [1, 4, 5, 8, 9, 11, 13, 14, 15, 18, 19, 21, 23, 24, 27, 28, 31, 32, 33, 37, 38, 41, 44, 50], "model_contrast": 13, "model_high": 5, "model_low": 5, "model_nam": 3, "model_scanvi": 7, "model_scvi": [7, 13], "model_select": 3, "modelmatselect": 8, "modelmetrics_1": 25, "moder": [2, 14, 15], "modern": [23, 24, 40, 50], "modest": 23, "modgene_act": 10, "modif": [7, 9, 19, 23, 24, 25, 26], "modifi": [1, 2, 7, 8, 9, 11, 16, 19, 21, 23, 24, 25, 28, 34], "modrna": 10, "modul": [5, 6, 7, 8, 11, 15, 16, 19, 21, 23, 25, 26, 27, 28, 36, 49], "modular": [23, 51], "modularli": 23, "moe": 3, "moerman": [15, 26], "mofa": 21, "mofa_1": 21, "mofa_20230103": 28, "mofa_umap": 21, "mofa_umap_": 21, "mofaumap_": 21, "mofaumap_1": 21, "moffett": 25, "moffitt": 39, "moham": [1, 16, 17], "mohammad": [3, 5, 7, 16, 17, 19, 37, 40, 41, 50, 51], "mohsen": [5, 16, 23, 51], "moira": [17, 26], "mojaveazur": 21, "mol": 24, "molcel": 24, "molecul": [5, 9, 18, 23, 24, 25, 33, 34, 39, 49, 51], "molecular": [1, 2, 7, 14, 15, 16, 17, 18, 22, 23, 24, 25, 29, 30, 34, 49, 50, 51], "molin": 50, "molina": 51, "molla": 27, "mollenau": 43, "molli": [14, 49], "molotski": 51, "moment": [23, 26, 51], "mompel": 15, "monaco": 17, "monica": 36, "monika": [3, 7, 17, 24, 50], "monitor": [2, 16, 18, 27, 28], "mono": [5, 7, 11, 12, 15, 26], "mono_1": 50, "mono_2": 50, "monochromat": 23, "monocyt": [5, 14, 15, 16, 19, 25, 46], "mononuclear": [2, 7, 14, 16, 19, 28, 34, 48, 51], "mont": 49, "montesclaro": [23, 24], "montgomeri": 16, "month": 49, "monther": 14, "montoro": 7, "montoya": 17, "moodi": 5, "moor": 48, "mootha": 15, "mor": 38, "mora": 1, "morani": 41, "more": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 33, 34, 37, 38, 39, 40, 43, 44, 46, 47, 48, 49, 50, 51], "morelli": 13, "moreov": [5, 14, 23, 24, 25, 48], "moreto": 23, "morgan": [1, 2, 7, 13, 19, 22], "mori": 49, "moritz": [17, 26, 36, 49], "morpholog": [2, 18], "morphologi": 37, "morri": [7, 11, 16, 27, 28, 34, 48, 49], "morshui": 36, "morten": 4, "mosaic": [27, 49], "mosh": [13, 22], "most": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 17, 19, 21, 22, 23, 24, 25, 26, 28, 30, 32, 34, 36, 37, 38, 43, 46, 47, 48, 49, 50, 51], "mostafa": [24, 51], "mostli": [1, 4, 5, 11, 16, 24, 31, 32, 33], "motamedi": 9, "motif": [2, 3, 4, 8, 26], "motif2tf": 26, "motif_back": 3, "motif_ifng": 3, "motif_path": 26, "motifmatchr": [8, 11], "motifmatchr_1": 8, "motiv": [2, 19], "mottok": 5, "moun": 11, "mour": 23, "mourragui": 38, "mous": [4, 5, 7, 15, 16, 17, 22, 23, 24, 26, 34, 37, 40, 41, 45, 47, 51], "mousa": 5, "moutinho": 24, "mouton": 17, "move": [1, 5, 6, 7, 14, 15, 16, 21, 23, 25, 27, 28, 29, 36, 49], "mpl": 1, "mpl_toolkit": [1, 7, 15, 21, 25], "mpo": [5, 12], "mpp": 5, "mpv17": 30, "mrna": [7, 9, 16, 17, 18, 23, 24, 34, 48, 50, 51], "mrpl15": [38, 41], "mrvi1": 38, "ms2": 24, "ms4a1": [5, 12, 27], "msb": [7, 14, 22, 29, 50, 51], "mse": 27, "msg": 4, "msgpack": 7, "msi2": [5, 12], "msigdb": 15, "mst": 50, "msu": 23, "mt": [7, 11, 21, 34, 36, 37], "mt2a": 25, "mt_gene": [36, 37], "mt_outlier": 34, "mtab": 3, "mtg": 27, "mtrnr2l1": 12, "mtx": 23, "mu": [11, 16, 19, 28, 33, 36, 37, 44, 45, 46, 47, 48, 51], "mu_": 36, "much": [1, 5, 6, 7, 11, 12, 13, 14, 16, 19, 23, 24, 33, 36, 38, 44, 49], "mudata": [7, 11, 13, 16, 18, 21, 28, 30, 44, 45, 46, 47], "mudataset": 19, "mudataseurat": [10, 21], "mueller": [7, 28], "muk22": 49, "mukamel": 9, "mukherje": 15, "mukhopadhyai": 49, "mulder": 37, "mulholland": 49, "multi": [1, 2, 3, 7, 8, 11, 14, 17, 18, 19, 22, 23, 25, 27, 36, 45, 48, 49, 51], "multi_chain": [1, 2, 4], "multi_id": 16, "multi_panel": 19, "multiassayexperi": 21, "multicellular": [24, 25], "multichain": 2, "multicolor": 49, "multicor": 3, "multicoreparam": 33, "multicoretsn": [3, 26], "multidimension": [14, 19], "multidisciplinari": 30, "multigr": [5, 28], "multim": 4, "multimap": 23, "multimod": [2, 5, 7, 9, 14, 16, 18, 24, 27, 28, 29, 30, 48, 49, 50], "multinomi": [13, 32], "multiom": [7, 9, 10, 11, 19, 27, 30, 34, 49], "multiome_donor_s4d8_pp_test": 10, "multiome_query_batch": 27, "multiome_reference_batch": 27, "multipl": [2, 3, 4, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 30, 34, 36, 41, 42, 48, 49, 51], "multiple_choice_quest": 42, "multipledispatch": 7, "multiplet": [11, 23, 48], "multiplex": [3, 7, 14, 15, 16, 23, 24, 25, 38, 39, 48, 50], "multipli": [17, 25, 38], "multipot": 5, "multiprocess": 16, "multiqc": 23, "multitask": 2, "multitud": 50, "multiva": 27, "multivari": 50, "multiview": 3, "mul\u00e8": 47, "mund": 29, "mundlo": 23, "munich": 30, "munsel": [7, 21], "munsell_0": [8, 25, 27, 28], "muon": [9, 11, 16, 18, 21, 28, 30, 43, 44, 45, 46, 47, 48], "muon_data": 10, "murnan": 50, "murphi": [14, 19, 29], "murrai": 36, "murrow": 23, "murthi": [5, 7, 50], "murugan": 1, "musculu": 49, "music_frac": 17, "music_prop": 17, "musicr": 17, "muskov": 23, "must": [1, 3, 4, 6, 7, 8, 13, 14, 16, 19, 21, 23, 24, 25, 49, 50, 51], "mustafah": 17, "mutat": [1, 2, 4, 23, 24, 25, 49], "mutation_prior": 49, "mutual": [1, 46], "muu": 7, "muxu": 49, "muzlifah": [25, 50], "mvi": 28, "mvtcr": 5, "mvtcr_embed": 3, "mx1": 25, "my_mudata": 19, "my_result": 19, "myadm": 8, "mycontrast": 14, "myelocyt": 5, "myeloid": [5, 12, 15, 17, 26, 36, 43], "myh10": 38, "myocardi": 36, "myocardium": 36, "myriam": 50, "myung": 25, "mzb1": [5, 12], "m\u00e4chler": 14, "m\u00fcller": 13, "n": [1, 2, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 26, 28, 31, 36, 37, 38, 41, 48, 49, 50, 51], "n1": 27, "n2": 27, "n_": [36, 38], "n_batch": [7, 36], "n_bg": 8, "n_cell": [1, 7, 11, 13, 14, 15, 19, 25, 28, 36, 37, 38, 49], "n_cells_by_count": [11, 19, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "n_cells_per_loc": 36, "n_cluster": 37, "n_comp": [5, 27, 33, 38], "n_compon": 19, "n_contig": 1, "n_count": [17, 27, 28, 36, 37, 43, 44, 45, 46, 47, 48], "n_extra_categorical_cov": [7, 36], "n_extra_continuous_cov": [7, 36], "n_feature_cutoff": 11, "n_features_per_cel": [10, 11], "n_gene": [3, 5, 14, 19, 25, 28, 36, 43], "n_genes_by_count": [11, 19, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "n_genes_detected_per_cel": 26, "n_hidden": [7, 16], "n_intbc": 49, "n_job": [3, 51], "n_label": [7, 36], "n_latent": [7, 16], "n_layer": [7, 16], "n_layers_decod": 27, "n_layers_encod": 27, "n_neighbor": [5, 13, 16, 17, 19, 26, 51], "n_ob": [1, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 50, 51], "n_our": 4, "n_out": 15, "n_pc": [6, 13, 19, 37, 44, 45, 50, 51], "n_perm": 40, "n_region": 28, "n_run": 3, "n_samples_per_group": 15, "n_subsampl": 16, "n_thread": 16, "n_top": 19, "n_top_gen": [3, 7, 13, 15, 17, 51], "n_topic": 8, "n_tss": [11, 19], "n_var": [5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 31, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 50, 51], "n_vdjdb": 4, "na": [1, 5, 7, 14, 15, 21, 25], "na_color": 5, "nabavi": 14, "nabhan": 7, "nabor_0": 8, "nabove2": 11, "nacho": 51, "nadel": 17, "nadhir": 16, "nadin": 36, "nadiya": 24, "nafissa": 16, "naftali": [5, 7, 25, 50], "nag00": 49, "nagai": [25, 36], "naghipourfar": [5, 16], "nagi": 49, "nagq": 14, "nahe": 49, "naiv": [1, 5, 7, 12, 14], "naived": 41, "najafabadi": 23, "nakano": 5, "name": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "namespac": [8, 15, 17, 25, 27, 28], "namit": 48, "namita": 1, "nan": [1, 2, 3, 4, 7, 17, 28, 34, 37, 41, 49], "nanami": 49, "nanargmin": 17, "nanjo": 49, "nannan": 4, "nano": 18, "nanobal": 37, "nanohol": 24, "nanolit": [2, 23, 24], "nanopor": 2, "naoki": 49, "nar": [2, 7, 9, 14, 25, 36, 38], "naranjo": 49, "naren": 24, "narrow": 23, "naruya": 49, "narwad": 9, "nat": [5, 8, 13, 14, 26, 30, 37, 41], "natali": 51, "natalina": 50, "natarajan": 24, "nath": 24, "nathan": [5, 7, 11, 14, 19, 23, 24, 25, 29, 50], "nathaniel": 2, "nation": [1, 4, 13, 15, 24, 51], "nativ": [11, 21, 23, 34, 49], "natmi": 25, "natsort": [1, 7, 15, 19, 21, 25], "nattermann": [17, 26], "natur": [1, 2, 3, 4, 5, 6, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 27, 28, 31, 33, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "nature14590": 50, "nature24489": [13, 22], "nau": [3, 4], "navarro": [11, 36], "nave": 40, "navig": 30, "nawijn": [5, 7, 50], "nax20": 1, "naxerova": 1, "nazaret": [7, 38], "nazor": [27, 28, 48, 50], "na\u00efv": 19, "nb": [4, 27, 28, 36], "nbclassic": 1, "nbformat": [1, 21], "nbinom_ufunc": [1, 7, 15, 21, 25], "nbmake": 26, "nbsp": 7, "nbt": [5, 6, 7, 24, 48, 50], "nc": [2, 3, 26], "ncam1": 27, "ncbi": 14, "ncell": 8, "ncf2": 8, "ncf_ufunc": [7, 15, 21, 25], "nchez": 26, "ncol": [1, 3, 8, 13, 14, 15, 27, 28, 36], "ncomms14049": [23, 24], "ncore": 8, "ncount_adt": 16, "ncount_gdo": 16, "ncount_hto": [16, 17], "ncount_rna": [14, 15, 16, 17, 25], "ncount_sct": [14, 15, 16, 25], "ncr1": 27, "nct_ufunc": 25, "ncx2_ufunc": 25, "nd": 4, "nd3": 7, "nd5": 7, "nd6": 7, "ndez": 16, "ndler": [17, 26], "ndownload": [2, 3, 5, 7, 15, 25, 31, 32, 33, 34, 36, 38, 43, 44, 45, 46, 47, 48], "ne": 23, "neal": 7, "nearest": [5, 6, 8, 13, 16, 23, 27, 34, 37, 50], "nearli": [11, 13], "necessari": [1, 2, 5, 7, 10, 13, 19, 21, 22, 23, 30, 45, 51], "necessarili": [5, 6, 13, 16, 18, 23, 24, 25, 34], "necessit": 23, "need": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 16, 17, 19, 21, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 40, 41, 48, 49, 50, 51], "needham": 5, "neeharika": 25, "neeraj": 15, "nef": 4, "neff": [7, 11, 27, 28, 34, 48], "neg": [2, 5, 8, 12, 13, 14, 15, 16, 17, 18, 23, 26, 28, 33, 36, 41, 47, 48], "neglect": [33, 41], "neglig": 4, "nehar": 11, "nei": 49, "neighbor": [3, 5, 6, 8, 11, 13, 15, 16, 17, 19, 21, 23, 26, 27, 31, 33, 34, 36, 37, 38, 40, 43, 44, 45, 49, 50, 51], "neighborhood": [3, 5, 7, 8, 13, 19, 31, 34, 37, 45, 49, 51], "neighbors_kei": 13, "neighbors_within_batch": 7, "neighbour": [6, 13], "neighbourhood": 34, "neighbouthood": 13, "neighor": 27, "neil": [13, 15], "nelson": 14, "nemanja": 24, "nemann": 15, "nematod": 49, "nemesh": [23, 24], "neocort": 24, "neocortex": 24, "neriman": 38, "ness": [23, 24, 50], "nest": [7, 13, 15, 28, 34, 48], "nested_model": 13, "net": [11, 27, 28, 34, 48], "network": [1, 3, 4, 5, 6, 7, 11, 15, 16, 19, 24, 25, 36, 37, 41, 49], "network_tutorial_rna_atac": 8, "network_tutorial_rna_n_atac": 8, "networkd3": [8, 11], "networkd3_0": 8, "networkx": [1, 27], "neu": 2, "neural": [5, 7, 11, 16, 27, 28, 34, 36, 41, 48, 51], "neurip": [6, 7, 8, 11, 27, 28, 34, 48], "neurips_2021": 27, "neurips_cite_pp": 27, "neurips_processed_input": 26, "neurips_processed_output": 26, "neurips_qc_filtered_allsamp": 10, "neurips_s1d1": 8, "neuron": [9, 16, 24, 36], "neutcount": 17, "neutral": 49, "neutralis": 4, "neutrophil": [5, 13, 17, 43], "neutrophils_1": 17, "neutrophils_2": 17, "neutrophils_3": 17, "neutrophils_4": 17, "neuwing": [17, 26], "never": [14, 25], "nevertheless": [1, 14, 25, 45, 47], "nevil": 16, "new": [3, 4, 5, 7, 8, 9, 11, 12, 13, 16, 18, 19, 23, 24, 26, 27, 28, 29, 30, 31, 34, 36, 38, 47, 48, 50], "new_": 27, "new_batch": 27, "new_donor": 27, "new_nam": 10, "new_ob": 15, "new_obs_column_nam": 27, "new_rank_zero_deprec": [7, 27, 28], "newbarcod": 2, "newcastl": [1, 2], "newcom": 30, "newer": [21, 22], "newli": [5, 11, 25, 29], "newman": 17, "newpag": 8, "next": [1, 2, 3, 4, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 31, 32, 34, 36, 37, 38, 39, 41, 48, 49, 51], "nextflow": [21, 23], "nextseq": 19, "neyman": 50, "nez": [49, 51], "nf": [16, 23], "nfeatur": 11, "nfeature_adt": 16, "nfeature_hto": [16, 17], "nfeature_rna": [14, 15, 16, 17, 25], "nfeature_sct": [14, 15, 16, 25], "nfeatures_atac": 8, "nfeatures_rna": 8, "nfia": 8, "nfib": 51, "nfrag": 11, "ng": 6, "ngai": 50, "ngene": [15, 26], "ngeneson": 14, "nghi": 24, "nghia": [5, 7, 44], "nghiem": 37, "ngn3": 51, "nguyen": [3, 4, 14, 15, 16, 24, 25, 37], "nh": 1, "nhlbi": 7, "nhood": 13, "nhood_adata": 13, "nhood_annot": 13, "nhood_annotation_frac": 13, "nhood_df": 13, "nhood_enrich": 40, "nhood_ixs_random": 13, "nhood_ixs_refin": 13, "nhood_kth_dist": 13, "nhood_neighbors_kei": 13, "nhood_retnlb_express": 13, "nhood_siz": 13, "nhu": 7, "nhuth": 14, "ni": [5, 7, 37, 50], "nice": [13, 49], "nicer": 11, "nich": [22, 25, 38], "nichenetr": 25, "nichenetr_1": 25, "nichol": [49, 51], "nichola": [2, 5, 7, 14, 16, 23, 24, 49, 50], "nick": [17, 24, 26], "nicki": 2, "nickola": 49, "nico": [17, 26, 37, 50], "nicol": [7, 9, 23, 50], "nicola": [17, 23, 50], "nicolai": 29, "nie": [25, 39, 41], "niebler": 23, "nielsen": [4, 14, 49], "nieto": [1, 2, 36], "nih": 14, "nik": 38, "nikaido": 24, "nikla": 3, "niklason": 25, "niknejad": 14, "niko": 14, "nikol": 5, "nikolai": [5, 7, 15, 16, 49, 50], "nikolao": 23, "nikolau": [6, 50], "nikoli": [7, 50], "nikolina": 1, "nil": [15, 25], "nili": 4, "nimh": 49, "nina": [1, 49], "nine": [24, 34], "ning": [13, 22, 23, 25, 26], "ninov": 49, "nir": [1, 4, 5, 6, 7, 9, 15, 24, 27, 28, 36, 38, 44, 49, 50, 51], "nirav": 2, "niro": 1, "nishimura": [23, 24], "nissen": [5, 14, 19, 27, 28], "nitin": 9, "nitish": 23, "nitzan": 38, "nk": [5, 7, 12, 15, 16, 25, 43], "nk_16hi": 1, "nk_cell": [14, 17], "nkain2": [5, 12], "nkg7": [5, 12, 19], "nkt": [5, 43], "nleimkuhl": 25, "nlm": 14, "nlme": [7, 21], "nlme_3": [25, 27, 28], "nmad": [34, 48], "nmeth": [7, 13, 14, 16, 19, 22, 23, 24, 41, 47, 48, 50], "nmf": 36, "nmi": [25, 28], "nmi_": 28, "nmi_al": 28, "nmi_clust": [7, 28], "nmi_max": 28, "nn": [8, 28], "nn_graph_gen": 37, "nn_graph_spac": 37, "nnerberg": [23, 24, 50, 51], "nnet_7": 25, "nnmat": 8, "nnstedt": 6, "nnz": [19, 33], "noah": 49, "nobuhiko": 49, "noc2l": 7, "node": [1, 3, 6, 13, 16, 18, 23, 25, 27, 49], "noga": [13, 22], "nois": [5, 6, 7, 11, 14, 16, 18, 23, 24, 25, 26, 27, 28, 31, 33, 41, 47], "noisi": [5, 25, 36, 51], "noisier": 48, "nolan": [4, 23, 24], "nolc1": 8, "nolegend": 27, "nolimits_": 41, "nomenclatur": 43, "nomin": 23, "non": [1, 2, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 23, 24, 27, 31, 32, 36, 41, 43, 47, 48, 49, 51], "non_covid": 2, "noncoval": 48, "none": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 17, 19, 25, 27, 32, 33, 36, 37, 40, 41, 42, 44, 45, 46, 47, 48, 49, 51], "nonetheless": [5, 23], "nonetyp": 21, "nonlinear": [33, 36], "nonspati": 41, "nonz_mean": 36, "nonz_mean_cutoff": 36, "nonzero": 13, "noqa": 27, "nor": [5, 22, 30], "norbert": [17, 26], "norm": [1, 7, 15], "norm_expr": 41, "norm_hist": 26, "norma": [7, 11, 27, 28, 34, 48], "normaeh23": 33, "normal": [1, 2, 5, 6, 7, 8, 11, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 27, 28, 30, 31, 32, 34, 37, 38, 41, 45, 48, 49, 50, 51], "normalis": [7, 14, 15, 33, 36, 38], "normalize_pearson_residu": 33, "normalize_per_cel": [17, 19, 34], "normalize_tot": [5, 7, 14, 15, 16, 21, 25, 27, 33, 37, 50], "normalized_count": 36, "normalizedata": 27, "norman": 49, "normdor38": 33, "normfeatur": 11, "normgsr20": 33, "normoblast": [5, 7, 12], "noscript": 42, "notabl": [13, 22, 24, 33, 50, 51], "notat": [11, 51], "notconvertedwarn": 21, "note": [1, 2, 3, 4, 5, 9, 11, 12, 13, 16, 17, 19, 21, 25, 27, 28, 33, 34, 36, 38, 41, 48, 49], "notebook": [1, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 19, 21, 25, 26, 27, 28, 32, 34, 36, 37, 38, 41, 42, 48, 49, 50], "notebook_tqdm": [5, 6, 15, 50], "notic": [1, 2, 5, 7, 13, 19, 23, 24, 49], "notion": [23, 36, 49], "notori": 23, "noushin": 49, "nov": [1, 5, 13, 15, 17, 22, 24, 25, 31], "nove": 37, "novel": [3, 4, 11, 24, 25, 49, 50], "novemb": [6, 7, 9, 13, 23, 24, 26, 37, 38, 41, 50], "novo": 25, "novotni": 24, "now": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 44, 45, 46, 47, 48, 50], "nowadai": 24, "np": [1, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 32, 34, 37, 41, 44, 48, 49], "npc": [9, 28], "nppb": 36, "nproc": 1, "nprot": 24, "nr": 26, "nr1d1": 15, "nrgn": 41, "nrip1": [5, 12], "nrow": 8, "nrp1": 27, "ns_fail": 11, "ns_pass": 11, "nsbm_level_": 13, "nsbm_level_0": 13, "nsbm_level_1": 13, "nsbm_level_1_color": 13, "nsbm_level_2": 13, "nsbm_level_2_0": 13, "nsbm_level_2_1": 13, "nsbm_level_2_10": 13, "nsbm_level_2_11": 13, "nsbm_level_2_13": 13, "nsbm_level_2_14": 13, "nsbm_level_2_2": 13, "nsbm_level_2_3": 13, "nsbm_level_2_4": 13, "nsbm_level_2_6": 13, "nsbm_level_2_7": 13, "nsbm_level_2_8": 13, "nsbm_level_2_color": 13, "nsbm_level_3": 13, "nsbm_level_3_0": 13, "nsbm_level_3_1": 13, "nsbm_level_3_2": 13, "nsbm_level_3_3": 13, "nsbm_level_4": 13, "nsbm_level_4_0": 13, "nsbm_level_5": 13, "nsplice": 23, "nt": [16, 49], "nt5c3a": 14, "nt5dc3": 12, "nt5e": 27, "ntarget": 8, "nter": 7, "ntron": 23, "nu": 11, "nuc_signal_filt": 11, "nuc_signal_threshold": 11, "nuclear": [8, 9, 11, 24], "nuclei": [9, 11, 36], "nucleic": [4, 7, 9, 14, 15, 18, 24, 25, 26, 36, 38, 49], "nucleobas": 4, "nucleoid": 24, "nucleom": 11, "nucleosom": 9, "nucleosome_sign": [11, 19], "nucleosome_signal_upp": 11, "nucleotid": [1, 2, 9, 18, 23, 24, 49], "nucleu": [5, 9, 11, 18, 23, 24, 26, 36, 40], "null": [7, 8, 11, 13, 16, 21, 25, 27, 28, 32], "num": 37, "num_cells_thresh": 49, "num_epoch": 38, "num_not_miss": 49, "num_of_cell_per_donor": 14, "num_sampl": [13, 36], "num_thread": 23, "num_uncut": 49, "num_warmup": 13, "num_work": 26, "numba": [1, 5, 7, 13, 15, 21, 25, 26, 31, 32, 33, 34, 43, 44, 45, 46, 47, 48], "numbadeprecationwarn": 5, "number": [1, 2, 3, 4, 5, 6, 7, 8, 9, 13, 14, 16, 17, 18, 19, 23, 24, 25, 26, 31, 32, 34, 36, 37, 38, 39, 40, 41, 46, 48, 50, 51], "number_dropped_intbc": 49, "number_observ": 19, "number_of_cutsit": 49, "number_of_edg": 27, "number_of_nod": 27, "number_of_sites_per_intbc": 49, "number_of_thread": 23, "number_vari": 19, "numcel": 49, "numcodec": 1, "numer": [1, 3, 4, 16, 23, 33], "numexpr": [1, 25], "numi": 26, "numpi": [1, 3, 4, 5, 7, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 30, 32, 34, 37, 44, 48, 49], "numpy2ri": [7, 28], "numpyro": 7, "numsaturatedtarget": 49, "nuniqu": [3, 49], "nurun": [19, 29], "nusbaum": 24, "nv": 11, "nvk": 4, "nx": 27, "nxm": 17, "nyquist": 7, "ny\u0155en": 24, "nzelmann": 15, "o": [1, 2, 3, 4, 5, 7, 11, 14, 15, 16, 17, 21, 23, 25, 26, 28, 33, 34, 36, 50, 51], "o0": 26, "oas1": 25, "ob": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 43, 44, 45, 46, 47, 48, 49, 50, 51], "obenchain": [19, 22], "obj": [7, 15, 27, 50], "objc": [13, 21], "object": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 49, 50, 51], "obligatori": 7, "obs_": 19, "obs_column_nam": 27, "obs_df": [38, 41], "obs_meta": 19, "obs_nam": [11, 13, 14, 19, 21, 27, 28, 34, 46, 48, 49], "obs_to_keep": 14, "obscur": [7, 18], "observ": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 18, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 48, 49, 50, 51], "obsm": [5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 41, 43, 44, 45, 50, 51], "obsp": [5, 7, 13, 15, 19, 21, 27, 28, 36, 37, 38, 40, 41, 43, 44, 45, 51], "obtain": [1, 2, 4, 6, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 32, 33, 34, 36, 37, 38, 39, 45, 48], "obviou": [23, 24, 49], "occup": 24, "occupi": [8, 26, 49], "occur": [1, 2, 13, 17, 18, 23, 24, 25, 36, 40, 49], "occurr": [4, 23, 48], "oct": [5, 17, 23, 25, 30, 34, 48], "octet": 49, "octob": [6, 7, 8, 21, 23, 36, 43], "ocular": 7, "od": 51, "off": [2, 4, 8, 14, 23, 28, 36, 37], "offer": [2, 5, 16, 19, 22, 23, 30, 31, 39, 49, 51], "offic": 25, "offici": [1, 2, 3, 4, 21], "offset": 7, "ofir": [13, 49], "ofra": 36, "often": [0, 2, 3, 4, 5, 7, 9, 11, 13, 14, 17, 18, 19, 21, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 36, 38, 40, 49], "og": 47, "ogunjimi": 2, "ohler": 7, "oi": 8, "ok": [2, 4, 21, 49], "oka": 23, "okimoto": 49, "okuda": 5, "ol": [19, 22, 29], "olabi": 50, "olbtv": 29, "old": [1, 29], "older": [21, 50], "oldest": 5, "oldformatwarn": 7, "olga": 49, "oligo": [16, 48], "oligonucleotid": [16, 18, 23, 24], "oliv": [5, 7, 14, 15, 17, 19, 24, 26, 28, 29, 36, 41, 48, 50], "oliva": 17, "olivar": 49, "oliveira": [7, 11, 27, 28, 34, 48], "olivi": [7, 24, 25], "olivia": [3, 4, 24, 40], "olkfm": 29, "oll": [19, 37, 40, 41], "oller": 17, "olsen": 24, "om": 16, "omer": [13, 22, 25, 36], "omic": [1, 2, 3, 7, 8, 15, 16, 17, 18, 19, 21, 22, 24, 26, 27, 36, 37, 39, 40, 41, 48, 49, 50], "omit": [14, 22], "omnipath": 15, "omnipathr": 25, "omp": [6, 13, 34], "omp_set_max_active_level": [6, 13, 34], "omp_set_nest": [6, 13, 34], "omri": 2, "on_": 28, "on_epoch_end": 28, "onc": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 16, 21, 23, 26, 34, 36, 38, 49], "onclick": 42, "oncogen": 49, "oncologi": 24, "ondrej": 43, "one": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 43, 46, 48, 49, 50, 51], "ones": [7, 11, 13, 15, 25, 32, 38, 45], "oneself": 15, "ong": 25, "ongo": [16, 22, 23, 25, 30], "onli": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 37, 38, 39, 41, 44, 46, 48, 49, 50, 51], "onlin": [5, 8, 22], "onlinelibrari": [6, 13, 14, 24], "ono": 49, "onset_of_symptom": 17, "onto": [4, 7, 9, 13, 28, 29, 31, 36, 38, 49, 50, 51], "ontologi": 15, "oo_1": 8, "oob": 8, "ooi": 24, "oord": 26, "opc": 16, "open": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "openproblem": 27, "openproblems_bmmc_multiome_genes_filt": [7, 8, 26], "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistop": 8, "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistopic_npeak": 8, "openproblems_bmmc_multiome_genes_filtered_atac_s1d1_counts_cistopic_npeaks10000": 8, "openproblems_bmmc_multiome_genes_filtered_s1d1_ciscorr": 8, "openproblems_bmmc_multiome_genes_filtered_s1d1_ciscorr_npeak": 8, "openreview": [11, 27, 28, 34, 48], "openssl_2": 8, "oper": [4, 18, 19, 23, 25, 27, 51], "operatornam": 33, "opig": 4, "opinion": [17, 25, 50], "oppermann": 24, "opportun": [14, 30, 49], "oppos": 27, "opposit": [13, 21], "opt": [1, 6, 13, 17], "opt_einsum": 7, "opt_louvain": 28, "optax": 7, "optim": [3, 4, 5, 7, 11, 13, 15, 16, 17, 22, 23, 25, 31, 41, 49, 50], "optimis": 38, "optimizewarn": 41, "option": [2, 3, 4, 5, 7, 8, 10, 11, 13, 16, 17, 18, 19, 21, 23, 24, 25, 28, 37, 42, 49, 50], "options_html": 42, "or4f5": [19, 36], "orabi": 23, "oran": 50, "orang": [16, 23, 36, 49], "oravecz": 51, "orchestr": [19, 22], "order": [1, 2, 3, 4, 5, 7, 9, 13, 15, 16, 17, 18, 21, 23, 24, 25, 30, 31, 33, 34, 36, 38, 41, 49, 51], "order_ligand": 25, "order_target": 25, "orderbi": 25, "orderby_ascend": 25, "ordereddict": [11, 19], "ordinari": 51, "orf": 24, "org": [1, 2, 4, 5, 6, 9, 11, 13, 14, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 47, 48, 49, 50, 51], "organ": [1, 2, 3, 4, 5, 7, 9, 11, 13, 16, 17, 18, 19, 23, 24, 25, 27, 28, 36, 38, 49], "organel": 24, "organis": 21, "organize_multiome_anndata": [27, 28], "organogenesi": [23, 37], "organoid": 13, "orient": [9, 49], "orig": [10, 16, 17], "origin": [1, 3, 4, 5, 7, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 27, 28, 31, 36, 37, 38, 42, 44, 49, 51], "originaldata": 17, "originalexp": [7, 27, 28], "orit": [5, 7, 13, 22, 24, 50], "orkin": 5, "ormerod": 13, "orphan": [2, 4], "orr": [7, 17, 50], "orthogon": [3, 9, 11, 13, 25, 31, 37, 38, 41, 50], "orthonorm": 31, "oscar": [7, 15], "oscil": 8, "oshlack": [7, 13, 23], "osnat": 24, "ostner": 13, "osx": 23, "ot": 49, "other": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 33, 34, 36, 38, 40, 43, 44, 45, 47, 48, 49, 50, 51], "other_d": 14, "otherchrom": 11, "otherwis": [1, 3, 4, 8, 13, 23, 27, 34, 36], "otto": 14, "ou": 37, "oudenaarden": [7, 31, 49, 50], "oup": [2, 4, 9, 14, 17, 19, 25, 36, 38], "our": [0, 1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 19, 22, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 43, 44, 45, 46, 48, 49, 50, 51], "ourselv": [5, 15], "out": [2, 3, 4, 5, 8, 11, 13, 14, 16, 19, 23, 24, 25, 26, 30, 34, 37, 38, 41, 46, 48, 50, 51], "out_dir": 23, "outcom": [2, 11, 14, 17, 18], "outdat": [19, 22], "outer": 5, "outfile_prefix": 3, "outgrow": 49, "outlier": [5, 11, 14, 27, 28, 34, 37, 38, 43, 44, 45, 46, 47, 48, 49, 50, 51], "outlin": [15, 23, 30, 42], "outlook": [3, 47], "outnumb": [1, 26], "outpath_adj": 26, "outperform": [5, 6, 7, 15, 24, 33, 34, 36, 38], "output": [1, 2, 4, 5, 7, 8, 11, 14, 15, 16, 19, 21, 23, 24, 26, 27, 28, 33, 34, 36, 42, 49], "output_clones_fil": 3, "output_data": 3, "output_dir": 23, "output_format": 23, "output_log": 3, "output_tcr": 3, "output_tessa": 3, "outsid": [8, 9, 11, 15, 16, 23, 49], "outstand": 33, "over": [1, 2, 3, 5, 7, 11, 13, 14, 15, 17, 19, 23, 24, 26, 30, 33, 34, 36, 41, 42, 48, 49, 50, 51], "overal": [1, 2, 3, 4, 5, 6, 7, 8, 11, 15, 16, 17, 22, 23, 24, 26, 28, 31, 36, 37, 39, 41, 49, 50], "overcom": [38, 49, 51], "overcorrect": [7, 34], "overcount": 23, "overcrowd": 1, "overdispers": 15, "overend": 48, "overfit": 16, "overflow": 42, "overhang": 23, "overhead": [21, 23], "overinterpret": 7, "overlai": 49, "overlaid": 7, "overlap": [1, 2, 4, 7, 8, 9, 11, 13, 15, 23, 26, 33, 38], "overlap_gen": 38, "overli": 23, "overload": [11, 19], "overloadeddict": [11, 19], "overlook": [7, 23, 25], "overrepres": [15, 23, 24], "overrid": [8, 21], "oversimplif": 25, "overview": [3, 5, 7, 11, 13, 14, 15, 16, 17, 22, 23, 25, 30, 37, 50], "overwhelm": 30, "overwrit": [8, 21, 27, 34], "overwritten": 21, "own": [1, 3, 5, 6, 11, 19, 23, 26], "ox": 4, "oxford": [2, 14, 24], "oxygen": [17, 24, 25], "oz": 37, "p": [5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 27, 28, 30, 34, 37, 40, 41, 42, 47, 48, 49, 50, 51], "p1": [11, 27, 33, 34, 36], "p10008": 6, "p17": 36, "p2": [11, 27, 33, 34], "p2rx1": 8, "p3": [11, 34], "p7": 36, "p8": 36, "p99": [5, 36], "p_g": 36, "p_val": 41, "paalb": 22, "paalhr22": 22, "pablo": [15, 50], "pacbio": 24, "pace": [29, 49], "pachter": [7, 23, 51], "pacif": 24, "pack": 9, "packag": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 25, 27, 28, 32, 33, 34, 36, 37, 40, 41, 48, 49, 50], "packer": 16, "paclik": [17, 26], "pad": [3, 42], "padj": 16, "pag": [19, 22], "paga": [6, 50], "page": [2, 3, 4, 7, 9, 15, 23, 30, 41, 49, 50], "pagerank": 25, "pagoda": 15, "pagoda2": 15, "pahbr": 22, "pahcg": 22, "pai": 49, "paid": 23, "pain": 24, "painless": 2, "pair": [1, 2, 3, 4, 7, 9, 15, 23, 24, 25, 27, 34, 36, 37, 38, 49, 50], "pair_to_plot": 1, "paired_integration_chapt": 28, "pairwis": [4, 7, 10, 13, 23], "pajukanta": 23, "palantir": 50, "palantir_branch_prob": 50, "palantir_branch_probs_cell_typ": 50, "palantir_diff_potenti": 50, "palantir_pseudotim": 50, "palett": [1, 11, 13, 25], "pall": 13, "palla": [5, 19, 25, 37, 40, 41], "palmotif": [1, 3], "palsson": 26, "palt19": 22, "pamela": 4, "pamp": 2, "pan": [4, 38, 49], "panagiota": 50, "pancrea": [17, 40, 51], "panda": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 17, 19, 21, 25, 26, 27, 28, 30, 36, 38, 47, 48, 49], "pandas2ri": [1, 7, 11, 14, 15, 17, 27, 28, 32, 33, 34], "pandoc": [7, 8, 21], "panel": [5, 17, 23, 28, 36, 38, 47], "panel_s": [1, 4], "panglaodb": 15, "panizzolo": 13, "papadopoul": 2, "papadopoulo": 49, "papalexi": [5, 7, 14, 16, 19, 27, 28, 48, 50], "papalexi_2021": 16, "papasokrati": [8, 9], "papavasili": 1, "papen": [5, 7, 50], "paper": [3, 5, 7, 13, 14, 16, 22, 24, 39], "paradigm": 25, "parallel": [8, 21, 23, 24, 50], "parallel_4": [25, 27, 28], "parallelli": [7, 21], "parallelly_1": [25, 27, 28], "param": [4, 7, 13, 16, 21, 26, 38], "paramet": [1, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 33, 34, 36, 37, 41, 43, 44, 45, 46, 49], "parameter": [7, 36], "parameteris": 36, "parametr": 41, "parametris": 36, "params_experi": 3, "params_optim": 3, "parasail": 1, "parasit": 13, "paratop": 4, "parekh": [23, 24], "parent": [24, 49, 51], "pari": 42, "park": [5, 7, 29, 36], "parkinson": 51, "parp12": 25, "parp14": 25, "parp9": 25, "parri": 24, "pars": [15, 23], "parsabl": 1, "parsi": 5, "parsimoni": [23, 49], "parso": [1, 7, 15, 21, 25], "part": [0, 2, 3, 5, 6, 7, 9, 11, 14, 15, 16, 19, 21, 23, 25, 26, 27, 30, 36, 44, 48, 49], "partial": [5, 13, 15, 24, 25, 48, 51], "particip": [7, 24], "particular": [5, 6, 7, 13, 14, 16, 18, 19, 23, 25, 26, 28, 36, 49], "particularli": [5, 7, 14, 15, 17, 21, 22, 23, 27, 30, 36, 40], "partit": [5, 6, 33, 34, 49, 50], "partli": [5, 7, 36], "partner": 19, "parvalbumin": 24, "pascal": [5, 7, 24, 50], "pasquini": 5, "pass": [1, 2, 5, 7, 11, 14, 19, 21, 23, 24, 25, 27, 28, 36, 37, 41, 48, 49, 51], "past": [0, 23, 36, 49], "paste0": [8, 10, 14], "pat": 15, "patchwork": [7, 8, 11, 21], "patchwork_1": [8, 25, 27, 28], "patel": [2, 9, 49], "paten": 24, "path": [1, 2, 3, 4, 5, 8, 11, 15, 19, 21, 23, 26, 44, 45, 46, 47, 48, 49, 51], "path_bcr": [3, 4], "path_bcr_contig": 3, "path_bcr_input": [2, 3], "path_bcr_out": 2, "path_conga_clon": 3, "path_conga_gex": 3, "path_data": [1, 2, 3, 4], "path_gex": 1, "path_gex_bcr": 3, "path_gex_tcr": 3, "path_model": 3, "path_r": 3, "path_reduced_tcr": 3, "path_tcr": [3, 4], "path_tcr_csv": 2, "path_tcr_input": 2, "path_tcr_out": 2, "path_tmp": 3, "pathlib": [5, 15, 21, 26, 51], "pathogen": [2, 5], "patholog": 13, "pathologi": 4, "pathwai": [7, 14, 16, 25, 48], "patienc": 27, "patient": [1, 2, 3, 4, 14, 15, 16, 17, 25, 26, 36], "patient_1015_ctrl": 14, "patient_1015_stim": 14, "patient_1016": 14, "patient_1016_ctrl": 14, "patient_1016_stim": 14, "patient_101_ctrl": 14, "patient_1039": 14, "patient_1039_ctrl": 14, "patient_1039_stim": 14, "patient_107_ctrl": 14, "patient_107_stim": 14, "patient_1244_ctrl": 14, "patient_1244_stim": 14, "patient_1256": 14, "patient_1256_ctrl": 14, "patient_1256_stim": 14, "patient_1488": 14, "patient_1488_ctrl": 14, "patient_group": 36, "patient_id": [1, 2, 4], "patient_inform": 2, "patient_region_id": 36, "patricia": [16, 26], "patrick": [2, 5, 23, 37, 50, 51], "patro": [23, 51], "patsi": [1, 25], "pattern": [1, 2, 3, 5, 6, 13, 14, 15, 17, 23, 24, 25, 26, 34, 37, 38, 41, 49], "pau": 15, "pauciti": 23, "paul": [3, 4, 5, 7, 11, 14, 19, 22, 23, 24, 25, 27, 28, 29, 34, 37, 48], "paula": 36, "paulovich": 15, "pavana": 49, "pavel": 14, "pawel": [23, 24, 50], "pawlowski": 13, "pax5": [5, 10, 12], "paz": 16, "pb_data": 15, "pbappli": [7, 21], "pbapply_1": [25, 27, 28], "pbdzmq_0": 8, "pbmc": [2, 11, 14, 16, 19, 25, 26], "pbmc10k_multiom": 19, "pbmc3k": 19, "pbmcapply_1": 8, "pc": [5, 6, 7, 13, 14, 15, 21, 27, 28, 31, 37, 43, 45], "pc1": [15, 25], "pc2": 15, "pc_std": 44, "pca": [5, 7, 13, 14, 15, 16, 17, 19, 21, 26, 27, 28, 33, 34, 37, 38, 43, 50, 51], "pca_scatt": 31, "pca_variance_ratio": 45, "pcaproject": 27, "pcbi": 51, "pcf16": 1, "pcm": 50, "pcr": [2, 18, 23, 24], "pcr_batch": [7, 28], "pcsk2": 51, "pct_counts_hb": 34, "pct_counts_in_top_100_gen": [21, 37], "pct_counts_in_top_200_gen": [21, 37], "pct_counts_in_top_20_gen": 34, "pct_counts_in_top_500_gen": [21, 37], "pct_counts_in_top_50_gen": [21, 37], "pct_counts_mt": [21, 31, 34, 37], "pct_counts_ribo": 34, "pct_dropout_by_count": [11, 21, 27, 28, 34, 37, 43, 44, 45, 46, 47, 48], "pd": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 28, 38, 47, 48, 49], "pd1": 5, "pdata": 25, "pdc": [5, 7, 12, 17, 26], "pdcd1": 12, "pdf": [2, 3, 5, 6, 13, 14, 17, 19, 22, 23, 24, 27, 28, 29, 30, 33, 36, 38, 47, 48, 50], "pdl1": 16, "pdl2": 16, "pe": [5, 7, 23, 50, 51], "peak": [8, 9, 10, 11, 13, 19, 23, 28, 47, 48], "peak_annot": [11, 19], "peak_mask": 8, "peak_typ": [11, 19], "peakvi": 9, "pearson": [13, 23, 25], "pechlivani": 23, "pecht": [17, 26], "pechyron": 49, "peculiar": 14, "pedagog": [23, 37, 41], "peddada": 13, "pedro": [17, 25, 49], "peer": 6, "peggi": 25, "pei": 5, "peidli": [50, 51], "peisker": 36, "peiwen": 7, "peiyong": 7, "pekcan": 23, "pellegrini": 17, "pemoavdm": 16, "pemobdc": 16, "pemofmt": 16, "pemojlwt21": 16, "pemokst": 16, "pemolntw20": 16, "pemolsdd": 16, "pemolwt19": 16, "pemopmb": 16, "pemora": 16, "pemorsp": 16, "pemosgk": 16, "pemosh": 16, "pemosmfr": 16, "pemossg": 16, "pemossk": 16, "pemoszhl": 16, "pemowdw22": 16, "pemowmendezmp": 16, "pemoysl": 16, "pen_arg": 13, "penalti": [4, 23], "pendergraft": 24, "pendingdeprecationwarn": 7, "peng": [5, 7, 25, 37, 41, 50], "pengcheng": 37, "pengyi": 13, "penland": 7, "penn": 24, "peopl": [0, 7, 19], "peptid": [2, 4], "per": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 29, 33, 34, 36, 37, 38, 39, 48], "peral": 15, "perc": 38, "perceiv": [13, 25], "percellqcmetr": 21, "percent": [14, 16, 17, 49], "percent_mito": 36, "percent_top": [11, 19, 34, 48], "percent_uncut": 49, "percent_uniqu": 49, "percent_unique_thresh": 49, "percent_unsaturated_targets_thresh": 49, "percentag": [2, 11, 23, 34, 37, 49], "percentil": [5, 11, 23, 26], "percentuniqu": 49, "percentunsaturatedtarget": 49, "perceptron": 3, "perdigoto": 13, "perez": 25, "perfect": [4, 5, 11, 25], "perfectli": [7, 23], "perform": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 48, 49], "performancewarn": 5, "perhap": [19, 25, 49], "pericyt": 36, "period": 11, "peripher": [2, 14, 16, 19, 51], "peripheri": 9, "perman": 16, "permiss": [11, 34, 36, 48], "permit": 23, "permut": [16, 25, 40, 41], "permuted_results1": 16, "permuted_results2": 16, "pernil": 50, "persist": [19, 51], "person": [1, 11, 15, 25], "perspect": [1, 22, 29, 42, 50, 51], "pert_kei": 16, "pertin": 48, "pertpi": [13, 14, 16], "perturb": [1, 3, 7, 13, 15, 18, 24, 26, 29, 30, 48, 49], "perturbation_model": 16, "perturbation_signatur": 16, "peseski": 4, "peshkin": [24, 50], "peter": [1, 4, 5, 7, 14, 15, 16, 17, 19, 21, 23, 24, 27, 28, 36, 47, 48, 49, 50, 51], "peterson": [7, 48, 49], "petljak": 49, "petr": 15, "petra": 50, "pett": 50, "petti": 50, "pettu": [3, 4], "petukhov": [50, 51], "pexpect": [1, 7, 15, 21, 25], "pez": [5, 7], "pezzulo": 14, "pfeiffer": [17, 26], "pfigshar": 2, "pfrt22": 25, "pham": [24, 37], "phan": [2, 24], "phane": 24, "phantomj": [8, 11], "pharmacophor": 16, "phase": [2, 8, 13, 16, 18, 19, 30, 51], "phenodata": 17, "phenomenon": [1, 24], "phenotyp": [1, 2, 3, 5, 14, 15, 16, 18, 21, 51], "phi": 13, "philip": 3, "philipp": [2, 17, 19, 23, 26, 31, 49, 50, 51], "phillip": [16, 23, 24], "philpott": 24, "phipson": [7, 14, 15], "phosphodiest": 18, "phosphoryl": [9, 43], "photocleavag": 24, "phylodynam": 49, "phylogeni": [17, 49], "physic": [2, 8, 24, 25, 37], "physio": 3, "physiolog": [36, 46], "pi_": 36, "pia": 7, "picelli": 24, "pick": [3, 11, 13], "pickard": 50, "pickl": 21, "pickleshar": [1, 7, 15, 21, 25], "pictur": [13, 25, 48, 49], "piec": [1, 24, 48], "pierc": 9, "pierr": [7, 11, 15, 26, 32, 33, 34, 36], "pierson": 37, "pieter": [2, 23], "pietil": 23, "pii": [5, 9, 14, 17, 24, 25, 26, 27, 28, 30, 34, 39, 40], "pik3r5": 15, "pil": [1, 7, 15, 21, 25, 37], "pillar": [7, 21], "pillar_1": [8, 25, 27, 28], "pilzer": 36, "pimentel": 23, "pin": [7, 39], "pinchback": 15, "pinello": [11, 14], "ping": 2, "pink": 49, "pinpoint": 14, "pioneer": 7, "pip": [5, 6, 7, 13, 14, 15, 16, 19, 25, 26, 27, 28, 36, 37, 38, 40, 41, 49, 50, 51], "pipe": 23, "pipecomp": [32, 33, 34], "pipelin": [2, 3, 7, 9, 11, 14, 15, 16, 17, 18, 19, 21, 26, 32, 33, 34, 39, 50, 51], "pipet": 24, "piran": 49, "pircher": 13, "pird": 4, "pisco": [7, 11, 27, 28, 34, 48], "pisegna": 23, "pitfal": [4, 51], "pivot": 4, "pixel": 37, "pk": 25, "pkg_resourc": [1, 7, 15, 21, 25], "pkgconfig": [7, 21], "pkgconfig_2": [8, 25, 27, 28], "pkl": 5, "pkm": 25, "pl": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 25, 26, 27, 28, 31, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 49, 50, 51], "place": [7, 19, 21, 23, 24, 25, 34, 38, 49, 51], "plagu": 25, "plai": [5, 17, 18, 19, 24, 49], "plan": [7, 11], "plan_kwarg": [5, 27], "plasma": [3, 5, 7, 12, 25, 43], "plasmablast": [3, 5, 12, 17], "plass": [6, 50], "plastic": 13, "plate": 2, "plateau": 8, "platelet": 5, "platform": [8, 15, 17, 18, 21, 23, 24, 25, 27, 28, 38, 49], "platformdir": [15, 21], "platypu": 2, "plaur": [5, 12], "plausibl": 25, "plcb1": [5, 12], "plcg2": [5, 12], "pleas": [1, 2, 3, 4, 5, 6, 7, 13, 14, 15, 19, 21, 23, 27, 28, 30, 34, 49, 50], "plethora": [25, 49], "plice": 23, "pliku": 25, "pliner": [5, 16], "plo": [1, 15, 23, 24, 51], "plot": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 19, 23, 25, 26, 28, 31, 32, 34, 36, 37, 40, 41, 45, 46, 48, 49, 51], "plot_barplot": 16, "plot_boxplot": 13, "plot_cell_annotation_sc": 38, "plot_da_beeswarm": 13, "plot_data_glob": 13, "plot_data_sampl": 13, "plot_dp_scatt": 16, "plot_draw_effect": 13, "plot_draw_tre": 13, "plot_edg": 13, "plot_effects_barplot": 13, "plot_effects_umap": 13, "plot_genes_sc": 38, "plot_heatmap": [14, 16], "plot_histori": 36, "plot_important_featur": 16, "plot_joint": 11, "plot_lda": 16, "plot_lollipop": 16, "plot_matplotlib": 49, "plot_milo_diagnost": 13, "plot_nhood_counts_by_cond": 13, "plot_nhood_graph": 13, "plot_perturbscor": 16, "plot_qc": 36, "plot_reg_mean_plot": 16, "plot_scatterplot": 16, "plot_spati": 36, "plot_stacked_barplot": 13, "plot_training_scor": 38, "plot_tss_max": 11, "plot_violin": 16, "plot_volcano": 25, "plotbcv": 14, "plotfigrheatmap": 8, "plotfigrnetwork": 8, "plotli": [7, 21], "plotly_4": [8, 25, 27, 28], "plotmarker2d": 8, "plotmd": 14, "plotnin": [1, 25], "plotsmear": 14, "plt": [1, 4, 5, 7, 11, 13, 14, 25, 26, 28, 32, 33, 36, 38, 49], "plu": 14, "plug": 49, "plugin": [5, 36], "plyr": [7, 21], "plyr_1": [8, 25, 27, 28], "plz22": 49, "pmbio": 21, "pmc4441768": 24, "pmcid": 24, "pmhc": [2, 4], "pmid": [4, 14], "pmlr": 7, "pna": [13, 24, 51], "png": [7, 21], "png_0": [8, 25, 27, 28], "po": [7, 44], "podoplanin": 45, "podxl": 38, "poe": 27, "pogson": 16, "poiding": 17, "point": [2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 16, 18, 23, 25, 26, 30, 31, 33, 34, 36, 37, 39, 40, 47, 48, 49, 50, 51], "poirion": 7, "poisson": [13, 18, 19, 21, 24, 28, 36], "pola": 7, "polanski": [2, 5, 50], "poldsam": 23, "poli": [7, 19, 24], "polonski": 1, "polya": 23, "polyclip": [7, 21], "polyclip_1": [25, 27, 28], "polygyru": 13, "polyleven": 1, "polym": 18, "polymeras": 24, "polymercas": 18, "polymorph": 2, "polynomi": 49, "polysaccharid": 4, "pomeroi": 15, "ponc": 51, "pone": 24, "pont": 30, "pooch": [43, 44, 45, 46, 47, 48], "pool": [14, 18, 23, 29, 33], "poor": [7, 11, 16, 23, 24, 32, 34, 49], "poorer": 16, "pop": 2, "popescu": 50, "popul": [1, 2, 4, 7, 11, 13, 14, 15, 16, 17, 18, 21, 24, 25, 26, 31, 34, 43, 44, 45, 47, 48, 49, 51], "popular": [9, 13, 14, 19, 23, 24, 36, 37, 49, 51], "popviewport": 8, "pore": 9, "portabl": 24, "portal": 5, "portion": 23, "portrai": 17, "portrait": 51, "pose": [7, 17, 30, 47], "posit": [1, 2, 3, 4, 5, 8, 9, 11, 12, 13, 14, 15, 18, 23, 24, 25, 26, 33, 34, 39, 42, 47, 48, 51], "posixpath": 19, "possibl": [0, 1, 2, 4, 5, 7, 10, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 42, 43, 48, 49], "possibleuserwarn": 36, "possibli": [5, 13, 15, 25, 51], "post": [5, 16, 23, 25, 30, 49], "post_sample_q05": 36, "posterior": [16, 23, 36, 49], "postmortem": 24, "potenti": [2, 6, 8, 14, 16, 18, 19, 22, 23, 24, 26, 29, 31, 34, 38, 39, 46, 49], "potential_ligand": 25, "pour": 7, "powel": [5, 7, 23, 50], "power": [2, 13, 14, 15, 16, 24, 43, 49], "powerlaw_0": 8, "poyner": 50, "pp": [1, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 44, 45, 47, 48, 49, 50, 51], "pp_adata": 38, "ppbp": 19, "ppp1r1a": 51, "ppr": 25, "pr": 14, "pracma_2": 8, "practic": [3, 7, 13, 14, 15, 16, 17, 19, 23, 25, 31, 33, 34, 37, 49, 50, 51], "pradyot": [3, 4], "pragmat": 16, "prashant": 49, "pratap": 24, "pratiksha": [16, 48, 50], "pratip": [16, 47, 48, 50], "pratt": 49, "prdm1": [5, 12], "prdm16": 12, "pre": [0, 1, 3, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 23, 25, 26, 27, 28, 37, 40, 41, 50, 51], "precalcul": 26, "preced": 25, "precis": [4, 5, 13, 14, 15, 23, 49], "precursor": [5, 24, 50, 51], "pred": [16, 37], "predat": 23, "predecessor": 51, "predefin": [5, 15, 39], "predict": [3, 5, 7, 11, 13, 17, 18, 23, 26, 27, 28, 34, 36, 37, 38, 48, 49], "predict_differential_priorit": 16, "predict_ligand_act": 25, "predicted_adt": 27, "prediction_label": 3, "predictions_high": 5, "predictions_high_adata": 5, "predictions_low": 5, "predictions_low_adata": 5, "predictor": [2, 17], "predominantli": 7, "preetish": [5, 7, 50], "prefer": [1, 6, 7, 11, 19, 24, 34], "preferenti": [1, 24], "prefix": [7, 19, 34, 36], "prefront": 16, "preissl": 9, "preliminari": [8, 33], "premis": [3, 38], "prep": 25, "prep_anndata": 14, "prepar": [2, 5, 13, 18, 19, 24, 36], "prepare_ligand_target_visu": 25, "preparebridgerefer": 27, "prepend": 36, "preprint": [16, 49], "preprocess": [2, 5, 6, 7, 8, 9, 11, 13, 15, 19, 23, 26, 27, 28, 30, 31, 32, 33, 34, 38, 48, 49, 50], "prerequisit": 9, "preselect": 38, "presenc": [3, 26, 33, 40, 46], "present": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 15, 16, 17, 18, 21, 23, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 43, 47, 48, 49], "preserv": [3, 4, 6, 7, 15, 23, 28, 31, 32, 33, 39, 42, 50], "press": [31, 50], "presto": 1, "presum": 49, "prete": 5, "pretend": 7, "pretrain": [3, 27], "pretti": 19, "preval": [13, 23], "prevent": [5, 11, 15, 16, 38], "previou": [1, 3, 4, 5, 7, 8, 9, 11, 15, 16, 19, 23, 26, 28, 45, 49], "previous": [1, 2, 3, 4, 5, 7, 14, 16, 19, 23, 25, 26, 29, 31, 34, 37, 38, 49], "prf1": [8, 12], "prigmor": [25, 50], "priluski": 4, "primari": [3, 4, 11, 13, 16, 18, 19, 21, 30, 49], "primarili": [16, 19, 23, 24, 30, 41, 49], "primary_complaint": 17, "primary_nt_allele_t": 49, "primary_nt_tumor": 49, "primary_onli": [1, 3, 4], "prime": [23, 24], "primer": [18, 24, 50], "primerid": 14, "princeton": 31, "princip": [6, 14, 16, 19, 31, 33, 34, 45, 50], "principl": [5, 7, 9, 11, 13, 16, 33, 34, 37, 50], "print": [2, 3, 4, 5, 7, 8, 11, 14, 19, 21, 23, 26, 34, 38, 48, 49], "print_head": [1, 19], "print_vers": 1, "prior": [5, 9, 11, 14, 15, 16, 17, 19, 23, 24, 26, 27, 28, 30, 36, 38, 49, 50, 51], "priori": [15, 45, 47, 51], "priorit": 25, "prioriti": [7, 8], "pritchard": 5, "privat": 1, "privet": 1, "privileg": 1, "prkce": [5, 12], "prkcq": 8, "prlic": 14, "pro": [3, 5, 23], "prob": [13, 37], "probabilist": [5, 7, 23, 27, 28, 36, 38, 49, 50], "probability_threshold": 49, "probabl": [1, 4, 7, 8, 13, 16, 18, 23, 25, 31, 36, 37, 38, 40, 48, 49, 50], "probe": [2, 24], "problem": [1, 4, 5, 6, 7, 8, 13, 14, 15, 18, 23, 29, 30, 31, 36, 38, 40, 49], "problemat": [2, 23], "proc": 50, "proc_1": 25, "proce": [14, 15, 19, 49, 50], "procedur": [7, 14, 15, 16, 23, 27, 38, 49, 50, 51], "proceed": [1, 4, 7, 13, 15, 24, 51], "process": [0, 1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 25, 26, 27, 28, 29, 30, 32, 34, 37, 38, 39, 40, 41, 44, 48, 49, 50, 51], "processx_3": 8, "prodlim_2019": 25, "produc": [1, 2, 3, 7, 13, 22, 23, 24, 25, 26, 30, 31, 34, 49, 51], "product": [1, 8, 11, 15, 25, 27, 28], "productive_b_vdj": 1, "productive_b_vj": 1, "productive_vdj": 1, "productive_vj": 1, "proerythroblast": [5, 7, 12], "profession": 30, "profil": [1, 3, 5, 7, 8, 9, 11, 13, 15, 16, 17, 18, 23, 24, 25, 26, 30, 31, 32, 34, 36, 38, 41, 47, 48, 49, 50, 51], "prog": [5, 7, 12], "progeni": 15, "progenitor": [5, 12, 13, 25, 49], "program": [1, 8, 15, 16, 19, 21, 23, 30, 31, 49], "progress": [1, 5, 14, 17, 18, 29, 30, 48, 49, 50], "progressbar": [44, 45, 46, 47, 48], "progressr": [7, 21], "progressr_0": [25, 27, 28], "prohibit": 16, "project": [3, 7, 8, 10, 11, 16, 19, 21, 23, 24, 27, 30, 31, 34, 38, 49, 50, 51], "project_cell_annot": 38, "project_gen": 38, "prokaryot": [24, 26], "prol": 17, "prolif": 5, "prolifer": [1, 2, 3, 17], "prom1": [5, 12], "prometheus_cli": [1, 21], "promin": [7, 13], "promis": [7, 15, 16, 17, 21, 30, 36, 49], "promises_1": [8, 25, 27, 28], "promot": [8, 11, 18, 21, 26, 49], "promotor": 24, "prompt": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "prompt_toolkit": [1, 7, 15, 21, 25], "promyelocyt": 5, "prone": [2, 14, 17], "pronounc": [44, 51], "prop": [13, 25], "prop_shared_cel": 28, "propag": 25, "propens": 49, "proper": [5, 7, 8, 15, 18], "properit": 49, "properli": [1, 7, 13, 14, 15, 19, 21, 23, 24, 26], "properti": [1, 2, 3, 4, 6, 13, 14, 16, 23, 24, 34, 38, 47], "proport": [1, 13, 17, 24, 25, 34, 36, 39, 49], "propos": [6, 9, 13, 17, 23, 25, 31, 32, 34, 41, 50, 51], "prospect": 49, "prospon": 4, "prot": [16, 19, 21, 44, 45, 46, 47, 48], "prot_": [21, 28], "prot_filtered_feature_bc_matrix": 48, "prot_raw": 48, "prot_raw_feature_bc_matrix": 48, "prot_var": 27, "protect": 2, "protein": [1, 2, 4, 5, 7, 8, 9, 11, 16, 17, 18, 19, 24, 25, 27, 28, 30, 34, 36, 43, 44, 45, 46, 47, 48, 50], "protein_count": 27, "protein_express": 28, "protein_expression_obsm_kei": [27, 28], "proteom": [24, 25, 39], "protocol": [2, 7, 9, 16, 18, 19, 23, 25, 34, 36, 48, 49, 50, 51], "protocoldata": 17, "prototyp": 36, "protpca": 21, "protpca_1": 21, "protumap": 21, "protumap_1": 21, "proud": 0, "prove": 34, "proven": 49, "provid": [1, 2, 3, 4, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 30, 31, 32, 34, 36, 37, 38, 39, 40, 41, 43, 48, 49, 50], "provok": 26, "proxi": [3, 8, 13, 16, 25, 48], "proxim": [5, 8, 9, 16, 25, 37, 40, 50], "proxy_0": 25, "prr": 2, "prtn3": 12, "prudent": 7, "prune": [3, 7, 23, 26], "prusti": 50, "pryhub": 5, "ps02": 1, "ps_1": 8, "pseudo": [1, 14, 25, 32, 33], "pseudo_metr": 3, "pseudoalign": 23, "pseudobulk": 25, "pseudocount": 13, "pseudorepl": 14, "pseudotempor": 18, "pseudotim": [18, 19], "psomopoulo": 23, "pst": 42, "psutil": [7, 15, 21], "pt": [3, 5, 13, 16], "ptbbdb": 50, "ptblp": 50, "ptbskt21": 50, "ptbwl": 50, "ptbww": 50, "ptcggr": 50, "ptch1": 8, "ptdc": 50, "ptebk": 50, "ptesl": 50, "pth": 15, "pthbuttnerw": 50, "pthl": 50, "pthlb18": 50, "ptikjallquistm": 50, "ptjwg": 50, "ptllo82": 50, "ptmac67": 50, "ptmlc": 50, "ptmsz": 50, "ptmullner11": 50, "ptpr": 12, "ptpr02": 50, "ptprc": 25, "ptqhq": 50, "ptsh": 50, "ptskl": 50, "ptsrf": 50, "ptssz": 50, "ptt": 49, "pttwve19": 50, "ptwhp": 50, "ptwry16": 50, "ptyprocess": [1, 7, 15, 21, 25], "pu": 49, "public": [1, 3, 4, 5, 7, 11, 13, 14, 16, 28, 36, 49, 50, 51], "publicli": [5, 7, 19, 21, 23, 49], "publish": [2, 3, 5, 6, 9, 15, 33, 36, 49], "pubm": 14, "pui": 37, "pulendran": 2, "pull": [21, 25, 27, 28], "pulliam": 37, "pullin": 5, "puls": 2, "pump": 51, "punctual": 1, "pura": 37, "purdom": 50, "pure": [11, 13, 37], "pure_ev": [7, 15, 21, 25], "purif": 17, "puriti": 3, "purpl": [13, 49, 51], "purpos": [4, 5, 6, 7, 8, 9, 13, 15, 16, 19, 25, 26, 36, 37, 38, 41, 44, 49], "purrr": [7, 21, 25], "purrr_1": [8, 25, 27, 28], "pursu": 16, "purushothama": [5, 7, 50], "pushviewport": 8, "put": [0, 1, 5, 8, 14, 23, 26, 36, 38, 49, 50], "puwen": 25, "pval": [13, 14, 15, 16, 25, 41], "pval_adj_col": 14, "pval_col": 14, "pval_norm": 41, "pval_norm_fdr_bh": 41, "pvals_adj": 14, "pvalu": [13, 14, 15], "pvalz": 8, "pvectorc": 1, "pw_alpha": 4, "pw_beta": 4, "px": 42, "py": [1, 3, 4, 5, 6, 7, 11, 15, 17, 19, 21, 25, 27, 28, 34, 36, 37, 41, 49, 50], "py2rpi": 21, "py_builtin": 21, "py_object": 21, "pyarrow": 1, "pycpars": [7, 15, 25], "pydata": [1, 21], "pydev_ipython": [1, 7, 15, 21, 25], "pydevconsol": [1, 7, 15, 21, 25], "pydevd": [1, 7, 15, 21, 25], "pydevd_concurrency_analys": [1, 25], "pydevd_file_util": [1, 7, 15, 21, 25], "pydevd_plugin": [1, 7, 15, 21, 25], "pydevd_trac": [1, 7, 15, 21, 25], "pygment": [1, 7, 15, 21, 25], "pynndesc": [5, 7, 15, 19, 26], "pyobjctool": 21, "pypars": [1, 7, 15, 21, 25], "pypi": [1, 19], "pyplot": [1, 4, 5, 7, 11, 13, 14, 25, 26, 28, 32, 33, 38, 49], "pyramid": 41, "pyramidal_lay": 40, "pyro": [7, 23], "pyrophosph": 24, "pyrosequenc": 24, "pyrsist": 1, "pyscen": 26, "pyscenic_aucell_stdout": 26, "pyscenic_ctx_stdout": 26, "python": [1, 2, 3, 4, 5, 6, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "python3": [1, 4, 5, 6, 7, 11, 15, 19, 21, 25, 27, 28, 34, 36, 37, 41, 50], "python38": 17, "python_h5mu_fil": 21, "pythonjsonlogg": 21, "pythonwarn": 16, "pytoml": 1, "pytorch": [5, 16], "pytorch_lightn": [4, 7, 27, 28, 36], "pytz": [1, 7, 15, 21, 25], "pytz_deprecation_shim": [7, 15, 25], "pzp": 38, "p\u0227l": 24, "q": [2, 3, 4, 7, 8, 11, 13, 14, 15, 16, 25, 26, 42], "q0": 8, "q05_cell_abundance_w_sf": 36, "q05_per_cluster_mu_fg": 36, "q1": 42, "q95_per_cluster_mu_fg": 36, "q_model": 27, "qaiser": [14, 16], "qc": [5, 19, 21, 23, 25, 26, 34, 49], "qc_var": 34, "qcgsr20": 34, "qclbc": 34, "qcmed": [7, 27, 28], "qcxl21a": 34, "qcxl21b": 34, "qcyb20": 34, "qcyck": 34, "qczt21": 34, "qerc18": 47, "qi": [3, 5, 7, 15, 50], "qian": [26, 37], "qiang": 5, "qiao": [2, 7, 51], "qiaonan": 15, "qiaozhen": 49, "qime": 24, "qin": 37, "qing": [25, 37, 39, 41], "qingm": 2, "qingtai": 4, "qiu": [23, 37, 50], "qiuyu": 26, "qivltqspsslavsvgekvtlsckssqsllysnnqknylawyqqk": 4, "qjo": 49, "qlf": [13, 14], "qo": 23, "qpcr": [18, 24], "qqhystpyt": 4, "qqyytypwt": 4, "qu": [36, 38], "quad": [36, 38], "quadrant": 11, "quadrat": 33, "quak": 24, "qualit": [9, 13, 16], "qualiti": [3, 4, 5, 7, 9, 14, 17, 18, 19, 24, 25, 28, 29, 33, 36, 38, 47, 51], "quan": [15, 37], "quanshui": 37, "quant": 23, "quant_dir": 23, "quant_out_dir": 23, "quantaf": 23, "quantif": [1, 5, 7, 48, 51], "quantifi": [1, 2, 3, 4, 5, 7, 8, 13, 14, 16, 21, 23, 24, 25, 26, 29, 32, 39, 40, 41, 48, 50], "quantil": [11, 17, 23, 26, 36, 51], "quantit": [7, 9, 16, 18, 23, 24, 28, 40, 49, 51], "quantiti": [2, 18, 23, 24], "quantiz": 50, "quants_mat": 23, "quants_mat_col": 23, "quants_mat_row": 23, "quarto": 21, "quartz": [17, 24], "quasi": [7, 14, 23], "queen": [7, 50], "quentin": [14, 16], "queri": [2, 3, 5, 7, 15, 23, 28, 48], "query_adata": 5, "query_adata_emb": 5, "question": [3, 4, 7, 9, 13, 15, 19, 21, 23, 24, 25, 30, 39, 42, 50], "question_id": 42, "quick": [7, 11, 15, 19, 23], "quickli": [7, 8, 21, 51], "quickstart": 19, "quickstart_mudata": 19, "quiescent": 34, "quiet": 27, "quietli": 8, "quinn": [47, 49], "quiroga": 50, "quit": [1, 5, 7, 17, 21, 28, 36, 37, 49], "quitz": 50, "qval": 41, "qvqlqqpgtelvnpgaslkmscktsgyrftsyiihwvkqtpgqgl": 4, "qvqlqqsgaelarpgasvklsckasgypftsyginwvkqrtgqgl": 4, "r": [1, 2, 3, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 19, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 47, 49, 50], "r0": [8, 15, 25, 27, 28], "r1": 49, "r10": 49, "r11": 49, "r12": 49, "r13": 49, "r14": 49, "r15": 49, "r16": 49, "r17": 49, "r18": [24, 49], "r2": [23, 49], "r25": 13, "r2_valu": 16, "r2d3": [8, 11], "r2d3_0": 8, "r2py": [7, 11], "r3": 49, "r4": 49, "r5": 49, "r6": [7, 21, 49], "r6_2": [8, 25, 27, 28], "r7": 49, "r8": 49, "r80__10kb_up_and_down_tss": 26, "r9": 49, "r_lib": 3, "r_object": 21, "r_to_pi": 21, "r_x": 23, "r_y": 23, "ra": 33, "raab": [17, 26], "rabinov": 7, "rachael": [24, 48], "rachel": [1, 2, 4, 7, 25, 49, 50], "raczkowski": 14, "radich": [23, 24], "radii": 40, "radio": 42, "radioact": 24, "radiolabel": 24, "radiu": [40, 42], "radmila": 24, "radu": 11, "raether": 29, "rafael": [14, 19, 22, 32, 36], "rafiqul": 50, "rage": 2, "raghav": 38, "raghubar": 37, "ragoussi": 23, "rahbari": 49, "raheleh": 49, "rahmani": [5, 23], "rahul": [5, 7, 9, 14, 15, 16, 19, 23, 24, 27, 28, 47, 48, 50], "rai": 14, "rainbow": 5, "raindrop": 23, "rainer": [24, 50], "rais": [1, 23], "raj": 49, "rajagop": [5, 7, 50], "rajewski": [6, 50], "rajiv": [23, 24], "raktima": [13, 22], "ralf": 23, "ralph": [9, 23], "ram": [5, 26], "ramachandran": 50, "ramakrishna": 49, "ramani": 16, "rambow": [15, 26], "ramilowski": 25, "ramirez": [7, 15, 25, 36, 50], "ramnik": [13, 22], "ramo": 25, "ramona": 36, "ram\u00edrez": [43, 44, 45, 46, 47, 48], "ran": [5, 7, 14], "rand": 31, "randel": 5, "randi": 4, "random": [1, 2, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 37, 49, 50], "random_3": [25, 27, 28], "random_forest_classifi": 16, "random_forest_regressor": 16, "random_se": 13, "random_st": [3, 11, 13, 15, 16, 19], "randomforest": 25, "randomforest_4": 25, "randomli": [1, 11, 16, 19, 21, 23, 24, 34], "randomst": 15, "rang": [5, 7, 9, 11, 13, 14, 16, 19, 21, 22, 23, 24, 25, 30, 33, 38, 44, 46, 47, 48, 49, 50], "ranger": [2, 3, 4, 9, 23, 37, 40, 41, 48], "rani": [24, 37], "rank": [5, 8, 13, 14, 15, 16, 23, 25, 26, 28, 31, 32, 36, 43, 50], "rank_aggreg": 25, "rank_genes_group": [3, 5, 14, 15, 16, 21, 37, 43], "rank_genes_groups_df": [14, 15], "rank_genes_groups_dotplot": [5, 43], "rank_zero": [7, 27, 28], "rank_zero_deprec": [7, 27, 28], "rank_zero_experi": [7, 27, 28], "rank_zero_warn": 36, "rankbi": 8, "rankdriv": 8, "rann": [7, 21], "rann_2": [25, 27, 28], "rao": [5, 7, 50], "raphael": [2, 5, 14, 19, 22, 27, 28, 37, 47, 48], "rapid": [2, 5, 23, 25, 29, 51], "rapidli": [2, 37], "rapmap": 23, "rare": [7, 9, 11, 14, 16, 17, 23, 24, 33, 34], "rare_ct_cut_off": 17, "raredon": 25, "rasa": 36, "rashel": 24, "rasmu": 49, "rat": [45, 47], "ratcliff": 14, "rate": [1, 13, 14, 17, 18, 23, 24, 25, 26, 27, 28, 36, 49, 51], "ratg13": 4, "rather": [3, 4, 5, 6, 7, 13, 15, 16, 19, 21, 23, 24, 25, 26, 31, 34, 36, 38], "ratio": [7, 11, 14, 18, 23, 26, 34, 41, 51], "ration": [4, 16], "raul": 25, "rautenstrauch": 7, "rautio": [23, 24], "ravel": [13, 49], "raw": [0, 1, 3, 5, 7, 8, 11, 14, 15, 18, 19, 21, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 41, 45, 47, 48, 49, 51], "raw10xgenomics21": 23, "raw_clonotype_id": 2, "raw_consensus_id": 2, "raw_feature_bc_matrix": 34, "rawarj": 23, "rawbfl": 23, "rawbk19": 23, "rawbpmp16": 23, "rawbruningt": 23, "rawbt": 23, "rawbwc": 23, "rawcpm92": 23, "rawcsq": 23, "rawdd": 23, "rawdsc": 23, "rawfar07": 23, "rawfdf": 23, "rawgp21": 23, "rawhfw": 23, "rawhwc": 23, "rawhz": 23, "rawizj": 23, "rawkyd21": 23, "rawli18": 23, "rawlin": 50, "rawlra": 23, "rawmb": 23, "rawmbl": 23, "rawmmg19": 23, "rawmp21": 23, "rawmsmme20": 23, "rawnmullerhs20": 23, "rawoem": 23, "rawphj": 23, "rawppc": 23, "rawpzv": 23, "rawrs00": 23, "rawshs17": 23, "rawsk18": 23, "rawsm": 23, "rawssgp16": 23, "rawssps21": 23, "rawtmp": 23, "rawwlk19": 23, "rawwoz97": 23, "rawyb20": 23, "rawyt": 23, "rawzhhjs22": 23, "rawzswm00": 23, "rawzt21": 23, "rawztb": 23, "raybould": 4, "raychaudhuri": [5, 7, 44], "raychowdhuri": [13, 22], "raymond": 49, "raz": 49, "rbd": 4, "rc": 11, "rc_context": [13, 36], "rcb": [32, 33, 34], "rcistarget": [8, 11], "rcistarget_1": 8, "rcolorbrew": [7, 21], "rcolorbrewer_1": [8, 25, 27, 28], "rcparam": [1, 4], "rcparamsdefault": 1, "rcpp": [7, 21], "rcpp_1": [8, 15, 25, 27, 28], "rcppannoi": [7, 21], "rcppannoy_0": [25, 27, 28], "rcpphnsw_0": 27, "rcsb": 4, "rctd": 36, "rcurl": [7, 21], "rcurl_1": [8, 15, 27, 28], "rd": [8, 25, 27, 28], "rdata": 3, "rdb": 3, "rdpu": 36, "re": [3, 4, 7, 11, 13, 14, 15, 21, 26, 30, 31, 34, 37, 38], "reach": [3, 5, 6, 7, 9, 24, 27, 28, 36, 37, 51], "react": [2, 16, 25], "reaction": [3, 4, 18, 24], "reactiv": [2, 3], "reactom": 15, "reactome_ddx58_ifih1_mediated_induction_of_interferon_alpha_beta": 15, "reactome_interferon_alpha_beta_sign": 15, "reactome_interferon_gamma_sign": 15, "reactome_interferon_sign": 15, "reactome_interleukin_6_sign": 15, "reactome_ion_channel_transport": 15, "reactome_leishmania_infect": 15, "reactome_mhc_class_ii_antigen_present": 15, "reactome_mrna_splicing_minor_pathwai": 15, "reactome_neutrophil_degranul": 15, "reactome_pathwai": 15, "reactome_platelet_activation_signaling_and_aggreg": 15, "reactome_rrna_process": 15, "reactome_signaling_by_interleukin": 15, "reactome_transl": 15, "read": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 14, 15, 17, 18, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 38, 41, 43, 44, 45, 46, 47, 48, 49, 51], "read2": 23, "read_10x_h5": [11, 34, 48], "read_10x_vdj": 2, "read_csv": [2, 3, 4, 5, 17, 26, 49], "read_elem": [7, 19], "read_h5ad": [7, 11, 19, 21, 26, 49], "read_h5mu": [21, 48], "read_layers_to_assai": 10, "read_lengh": 23, "read_length": 23, "readabl": 16, "readbitmap_0": 8, "readcount": 49, "reader": [2, 13, 19, 21, 22, 23, 25, 27, 30, 33, 36, 37, 39, 49], "readh5ad": [8, 21], "readh5mu": [10, 21], "readi": [11, 23, 24, 47, 50], "readili": [23, 38, 51], "readm": 1, "readout": [8, 16, 19, 24, 26, 36, 49], "readr_2": [8, 25], "readrd": [8, 25, 27], "reads1": 23, "reads1_fil": 23, "reads1_pat": 23, "reads2": 23, "reads2_fil": 23, "reads2_pat": 23, "reads_in_peaks_frac": 11, "readthedoc": [5, 6, 15, 19, 27, 49, 50], "reagent": [24, 48, 49], "real": [7, 13, 15, 16, 18, 19, 24, 26, 29, 36, 51], "realist": [15, 49], "realiti": [5, 19, 29, 49], "realiz": 19, "realli": [13, 16, 26, 38], "realm": 49, "reanalysi": 29, "reap": 48, "rearrang": 1, "rearrangement_statu": 1, "rearrangement_status_vdj": 1, "rearrangement_status_vj": 1, "reason": [5, 7, 8, 11, 17, 18, 19, 21, 23, 26, 30, 34, 36, 38, 49, 51], "reassess": 34, "reassign": 23, "rebecca": [13, 22, 24, 36], "rebekka": [25, 36], "recal": 4, "recalcul": [16, 27], "recapitul": [40, 49], "receiv": [1, 3, 4, 9, 16, 23, 49], "receiver_celltyp": 25, "receiver_express": 25, "recent": [2, 3, 4, 5, 7, 13, 14, 15, 16, 19, 21, 23, 25, 27, 28, 30, 33, 49, 50, 51], "receptor": [1, 3, 4, 18, 19, 24, 49], "receptor_arm": [1, 3, 4], "receptor_complex": 25, "receptor_mean": 25, "receptor_prop": 25, "receptor_subtyp": [1, 2], "receptor_typ": [1, 2], "receptorn": 25, "rechavi": 51, "reciev": 3, "recipes_1": 25, "reciproc": 13, "recogn": [2, 3, 4, 5, 13, 26, 30], "recognit": [1, 2, 3, 4], "recombin": [1, 14], "recombinas": 49, "recombinatori": 2, "recommend": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 29, 30, 36, 37, 41, 44, 45, 49, 51], "recomput": [13, 15], "reconcil": [6, 26, 50], "reconstruct": [2, 7, 16, 27, 36, 50], "reconstruction_loss_valid": 28, "record": [1, 16, 23, 25, 27, 28, 49, 50], "recov": [2, 8, 16, 23, 24, 26, 38, 49, 51], "recover_dynam": 51, "recoveri": [17, 18, 23, 24, 49], "recreat": 31, "recruit": 9, "rectangl": 36, "recurr": 23, "red": [5, 11, 13, 14, 16, 23, 24, 26, 42, 49], "redetzki": [17, 26], "redirect": 23, "reduc": [1, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 18, 21, 23, 24, 25, 27, 28, 31, 32, 34, 36, 38, 41, 45, 50, 51], "reduce_lr_pati": 27, "reduceddim": [8, 21], "reduceddimnam": [7, 21], "reduct": [1, 6, 7, 9, 10, 11, 13, 16, 19, 21, 27, 28, 32, 33, 34], "redund": [26, 31], "reem": 2, "ref": [23, 25, 27], "ref_adata_ob": 5, "ref_dir": 23, "ref_emb": 5, "refdata": 27, "refer": [10, 18], "referenc": [21, 23], "reference_cell_typ": 13, "reference_embed": 5, "reference_model": 5, "reference_model_featur": 5, "reference_or_queri": 5, "refin": [5, 6, 7, 13, 23, 26, 30], "refined_pr": 37, "refined_spagcn_domain": 37, "reflect": [1, 4, 5, 6, 8, 9, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 34, 37, 41, 46, 48], "reformul": 51, "refqueri": 27, "refresh": 19, "refseq": 23, "refseq_r80": 26, "refugio": 49, "reg": [12, 26, 38], "reg_mean_plot": 16, "regalado": 49, "regard": [1, 2, 4, 5, 15, 19, 23, 24, 25], "regardless": [14, 15, 21, 48], "regen": 30, "regev": [5, 6, 7, 13, 22, 23, 24, 25, 38, 48, 50], "regex": 25, "regier": [5, 7, 27, 28, 38, 44, 49], "region": [1, 2, 4, 5, 6, 8, 9, 10, 11, 14, 18, 19, 22, 23, 24, 27, 28, 31, 40, 49, 51], "region_clust": 36, "regionstoexclud": 11, "regist": [21, 27], "registri": [7, 36], "regplot": 14, "regress": [5, 7, 13, 15, 17, 33, 36, 41, 51], "regress_out": 41, "regressionmodel": 36, "regul": [2, 8, 9, 14, 15, 16, 18, 25, 26, 50, 51], "regular": [10, 15, 16, 17, 29, 33, 36, 48], "regularli": 19, "regulatori": [5, 9, 11, 15, 19, 24, 27, 30, 50], "regulon": 8, "regulondb": 26, "regulonsauc": 26, "reichart": 7, "reid": [13, 15], "reidenbach": 9, "reimplement": 16, "reinder": [5, 14, 38], "reinforc": 4, "reiniu": 24, "reintegr": 5, "reiss": 2, "rel": [5, 7, 13, 14, 15, 16, 17, 18, 21, 23, 24, 26, 34, 42, 43, 47, 48, 49, 50], "relabel": 37, "relaps": [14, 24], "relat": [1, 2, 3, 4, 5, 6, 8, 11, 13, 15, 18, 23, 24, 26, 33, 38, 40, 49], "related_medication_and_anti": 17, "relationship": [3, 8, 11, 13, 16, 18, 23, 24, 25, 26, 28, 36, 49], "releas": [1, 2, 3, 4, 7, 22, 24, 28, 30], "relev": [1, 2, 4, 5, 7, 8, 11, 15, 16, 17, 19, 23, 25, 26, 28, 29, 32, 45, 48, 49, 51], "relevel": 14, "reli": [2, 3, 4, 5, 7, 13, 15, 17, 21, 22, 23, 24, 25, 30, 36, 38, 49, 50, 51], "reliabl": [14, 18, 21, 23, 30, 37, 51], "relianc": 25, "reliantli": 51, "reload": 11, "reload_ext": 11, "reloc": 1, "remain": [2, 3, 4, 16, 17, 19, 23, 24, 32, 34], "remaind": 5, "remark": [30, 38], "remco": 36, "rememb": [7, 13, 19, 23, 49], "remind": [7, 15, 25], "remit": 14, "remodel": 9, "remot": [21, 23, 25, 27, 28], "remov": [1, 2, 3, 4, 5, 8, 11, 14, 15, 16, 17, 18, 19, 23, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 39, 45, 46, 47, 48, 51], "ren": [9, 14, 24, 37, 39, 41], "renam": [3, 4, 10, 11, 15, 16, 25, 27, 28], "rename_axi": 15, "rename_protein": 27, "renameassai": [27, 28], "renata": 49, "renaud": [6, 17], "renchao": 16, "rene": [7, 48], "rensk": 4, "reorder": [16, 19], "reorder_categori": [13, 19], "reorth": 11, "rep": [3, 14, 17, 26], "rep_idx": 14, "repeat": [1, 6, 11, 14, 15, 16, 27, 28], "repeatedli": 50, "repel": 27, "repertoir": [3, 4, 24, 49], "repertoire_overlap": 1, "repetit": [1, 11], "replac": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "replic": [13, 14, 15, 16, 24, 25], "replicate_color": 14, "replicatepatient_1015": 14, "replicatepatient_1016": 14, "replicatepatient_1039": 14, "replicatepatient_107": 14, "replicatepatient_1244": 14, "replicatepatient_1256": 14, "replicatepatient_1488": 14, "replicates_per_pati": 14, "replogl": [16, 49], "report": [4, 5, 6, 9, 13, 15, 17, 19, 21, 23, 25, 26, 30, 48, 49, 50], "repositori": [3, 30], "repr": 8, "repr_1": 8, "repres": [1, 2, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 18, 19, 23, 25, 28, 32, 33, 34, 36, 37, 40, 46, 49], "represent": [1, 3, 4, 5, 6, 7, 13, 15, 16, 18, 19, 21, 26, 27, 28, 31, 32, 34, 36, 37, 45, 49, 50, 51], "repress": [8, 51], "repressor": 8, "reproduc": [7, 19, 24, 29], "reproduct": 24, "reprogram": 49, "request": [1, 2, 4, 5, 21, 30, 37, 48, 49], "requir": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 43, 44, 45, 47, 48, 49, 50, 51], "rerun": [3, 5, 23, 27, 28, 36], "res_conga": 3, "res_max": 28, "resampl": 13, "research": [0, 3, 4, 5, 7, 9, 14, 15, 18, 23, 24, 25, 30, 31, 36, 38, 49, 50], "resembl": [23, 24, 47, 48], "reserv": 6, "reset": [7, 11, 36, 37], "reset_index": [1, 2, 4, 38], "reset_sourc": 50, "reshap": 27, "reshape2": [7, 21], "reshape2_1": [8, 25, 27, 28], "resid": [5, 13, 48], "resid_expr": 41, "residu": [4, 13, 51], "resin": 24, "resist": 24, "resolut": [5, 6, 7, 13, 16, 17, 18, 19, 24, 25, 33, 36, 37, 38, 43, 49, 50, 51], "resolv": [2, 4, 16, 22, 23, 24, 38, 41, 49, 50], "resort": 45, "resourc": [4, 8, 11, 15, 21, 23, 25, 26, 30, 36, 39, 45, 48], "respect": [0, 2, 3, 6, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 39, 40, 41, 50], "respiratori": [2, 34], "respond": [3, 15, 16, 24], "respons": [1, 2, 3, 4, 7, 13, 15, 18, 21, 24, 25, 30, 38, 49, 51], "ressourc": 3, "rest": [1, 2, 3, 5, 7, 13, 15, 23, 25, 49], "restart": 8, "restfulr_0": 8, "restor": [4, 27], "restrict": [1, 4, 19, 21, 23, 24], "result": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 36, 37, 38, 40, 41, 49, 50, 51], "result_meta": 3, "results_adjac": 26, "retain": [7, 15, 23], "reticul": [7, 21, 25, 27, 28], "reticulate_1": [8, 25, 27, 28], "reticulate_list": 21, "reticulocyt": 12, "retina": 7, "retir": 21, "retkut": 49, "retnlb": 13, "retnlb_express": 13, "retriev": [5, 8, 16, 25, 26, 38, 44, 45, 46, 47, 48], "retrospect": 49, "return": [1, 4, 7, 10, 11, 14, 15, 16, 19, 21, 25, 27, 28, 34, 36, 37, 38, 48, 49], "return_all_lr": 25, "return_info": 15, "returngenelist": 8, "reuben": 16, "reus": [26, 48], "reusabl": 0, "reusch": [17, 26], "reuter": 51, "rev": [8, 25, 30], "rev_comp": 1, "reveal": [2, 3, 5, 6, 7, 13, 15, 16, 17, 23, 24, 30, 32, 33, 34, 38, 40, 42, 48, 49, 50, 51], "revers": [2, 3, 18, 21, 23, 24, 33, 44], "revert": 3, "review": [1, 2, 4, 22], "revolution": 24, "revolutionari": 49, "rey": [19, 22], "reynold": [1, 2, 50], "rez": [5, 26], "reza": 49, "rf4": [5, 12], "rfc3339_valid": 21, "rfc3986_valid": 21, "rfm22": 49, "rfpl1": 8, "rgba": 7, "rgcc": 16, "rgdal": 21, "rge": 50, "rgen": [17, 26], "rgeo": [7, 21], "rgs18": 49, "rhdf5": 21, "rhdf5filter": 21, "rhdf5lib": 21, "rhesu": 1, "rho_": 36, "rhoq": 8, "rhou": 41, "rhpcblasctl_0": 8, "riba": 51, "ribo": 34, "ribonucl": [18, 24], "ribosom": 34, "ricard": [7, 28], "ricardo": [15, 24, 25, 36], "riccardo": 50, "rich": [7, 16, 24, 50], "richard": [5, 13, 23, 24, 37], "richardson": [5, 47, 50], "richoz": 5, "richter": [19, 29, 37, 40, 41], "rick": 23, "rickard": [23, 24], "ridder": 14, "rideout": 49, "rie": 51, "rieck": [7, 11, 27, 28, 34, 48], "rieder": [2, 13, 19], "riek": [17, 26], "riemondi": 5, "riesenfeld": 23, "right": [3, 5, 8, 11, 13, 14, 21, 23, 26, 27, 33, 36, 41, 46, 49, 51], "rigor": [7, 19, 51], "rimorin": 24, "rinterface_lib": [14, 27, 28, 32, 33, 34], "rio": 8, "rise": [2, 11, 49], "risk": [5, 7, 11], "risso": [14, 22, 50], "rita": [40, 51], "ritchi": [14, 15, 23], "riza": [16, 49], "rizvi": 23, "rj": [14, 21], "rjson_0": [8, 25], "rkegren": 15, "rkmd21": 4, "rlang": [7, 21], "rlang_1": [8, 25, 27, 28], "rleifsson": [23, 51], "rlqslqtyv": 4, "rm": 49, "rmarkdown": [8, 21], "rmarkdown_2": 8, "rmpfr": [8, 11], "rmpfr_0": 8, "rn": [23, 24, 51], "rna": [2, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 28, 29, 30, 31, 32, 33, 36, 38, 39, 40, 43, 44, 45, 46, 47, 48, 49, 50], "rna1": 27, "rna1_queri": 27, "rna1_ref": 27, "rna2": 27, "rna2_queri": 27, "rna2_ref": 27, "rna_": 10, "rna_cit": 27, "rna_cite_bridg": 27, "rna_cite_queri": 27, "rna_cite_ref": 27, "rna_count_bas": 38, "rna_count_based_dens": 38, "rna_filtered_feature_bc_matrix": 48, "rna_hidden": 3, "rna_hvg": [27, 28], "rna_hvg_cit": 27, "rna_hvg_multiom": 27, "rna_indices_end": 27, "rna_multiom": 27, "rna_multiome_queri": 27, "rna_num_lay": 3, "rna_raw": 48, "rna_raw_feature_bc_matrix": 48, "rna_snn_r": 17, "rna_var": 27, "rna_veloc": 51, "rnag": 8, "rnamat": 8, "rnapca": 21, "rnapca_1": 21, "rnase": 24, "rnaumap": 21, "rnaumap_1": 21, "rng": 13, "rng_kei": 13, "ro": [32, 33, 34], "roadmap": [25, 49, 51], "roam": 17, "roast": 15, "rob": [23, 25, 51], "robbiani": 2, "robert": [2, 5, 7, 15, 17, 19, 22, 23, 24, 25, 26, 49, 50], "roberto": 1, "robin": [3, 7, 25], "robinson": [6, 11, 13, 14, 32, 33, 34], "robject": [1, 7, 11, 14, 15, 17, 21, 27, 28, 32, 33, 34], "roboto": 8, "robrecht": [7, 11, 27, 28, 34, 48, 50], "robust": [5, 7, 11, 13, 14, 15, 16, 19, 23, 24, 25, 31, 34, 36, 38, 41, 44, 47, 48, 49, 50, 51], "robustli": [2, 23, 36, 50, 51], "robyn": 4, "roch": 24, "rock": 5, "rocm": 5, "rocr": [7, 21], "rocr_1": [25, 27, 28], "roden": [2, 24], "rodriguez": [15, 25, 26, 36, 49], "roe": 23, "rogel": [13, 22], "roger": [5, 14, 19, 24, 27, 28, 48, 50, 51], "rogier": 36, "rogn": 23, "roi": [23, 50], "roja": 5, "rojo": 5, "roland": 40, "role": [1, 16, 17, 18, 25, 49], "romain": [5, 7, 23, 27, 28, 36, 38, 44, 49], "romi": 11, "ronaghi": 24, "ronald": [8, 50], "ronches": 36, "rongbin": 25, "rongxin": 9, "ronquist": 49, "root": [14, 38, 49, 50], "root_ix": 50, "rosa": 7, "rose": 17, "rosebrock": 49, "rosen": [5, 7, 13, 22, 24, 50], "roser": [25, 36, 41], "rosetta2": 23, "ross": [24, 49], "rosshandl": 51, "rotat": [5, 26, 50], "rotatei": 42, "rotation_mod": 26, "rough": [11, 19, 30], "roughli": [13, 14, 16, 36, 40, 41, 48], "round": [7, 11, 13, 16, 18, 23, 27, 28, 34, 48], "roundtoint": 34, "rount": 34, "roussi": 1, "rout": 49, "routin": [6, 13, 15, 25, 34, 49], "row": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 17, 18, 19, 21, 23, 25, 34, 37, 38, 49], "row_attribut": 26, "row_index": 21, "row_linkag": 4, "rowdata": [7, 21, 32], "rowen": 50, "rownam": [7, 8, 10, 14, 15, 21, 25, 27, 28, 34], "rownames_to_column": 25, "rowpair": 21, "rowsum": [8, 17, 34], "royal": [13, 14], "rozenblatt": [5, 7, 13, 22, 24, 50], "rp": 34, "rp1": 38, "rp11": 19, "rpart": 7, "rpart_4": [25, 27], "rpd": 21, "rpkm": 7, "rpl": 34, "rpl13": 41, "rprojroot_2": 8, "rpy2": [1, 7, 11, 13, 14, 15, 17, 21, 25, 27, 28, 31, 32, 33, 34], "rr": 25, "rrna": [13, 18], "rrs1": 41, "rsamtools_2": 8, "rscript": 3, "rsparse_0": 8, "rspectra_0": [8, 27], "rsqlite_2": 8, "rss": [13, 14], "rstatix": 25, "rstudio": [7, 21, 27, 28], "rstudioapi_0": [8, 25], "rsw06": 4, "rt": [18, 24], "rtesi": 7, "rtracklay": 11, "rtracklayer_1": 8, "rtsf": 23, "rtsne": [7, 21], "rtsne_0": [25, 27, 28], "ru": [7, 44], "ruaidhr\u00ed": 13, "ruan": 5, "rubanova": 49, "rubelt": [3, 4], "ruben": [7, 37], "rubric": 23, "rudimentari": [14, 19, 24], "rudolf": [17, 26], "rudolph": 4, "rue": 22, "ruedi": 48, "ruff": 50, "rui": [5, 15, 25, 37], "ruitenberg": 37, "ruizhi": 31, "rule": [11, 13, 19, 23, 24, 26, 49], "ruli": 49, "rumker": 5, "run": [1, 2, 4, 5, 6, 7, 8, 11, 14, 16, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "run_aucel": 15, "run_conga": 3, "run_gsea": 15, "run_harmoni": 44, "run_model_select": 3, "run_nut": 13, "runcgsmodel": 8, "runfigrgrn": 8, "rungenepeakcorr": 8, "runpca": [27, 28], "runspca": 28, "runtim": [1, 3, 11, 14, 38], "runtimewarn": [11, 17, 36], "runumap": [8, 27, 28], "runx2": 26, "ruslan": [50, 51], "russ": 24, "russel": [17, 37, 41, 50], "russkikh": [7, 16], "rust": 23, "rustom": 2, "ruth": [13, 16], "rxra": 8, "ryan": [5, 9, 23, 24, 49], "ryann": 3, "ryazantsev": 7, "rybakov": [5, 19, 37, 40, 41], "ryg": 25, "ryk": 25, "ryr3": [5, 12], "ryu": 17, "ryvkin": [23, 24], "rzw4ugaacaaj": 31, "r\u00b2": 16, "s0016508520353993": 40, "s0092": [17, 26], "s0092867421005833": [5, 27, 28], "s0092867422006511": 5, "s0092867422007838": 5, "s0168": 30, "s0952791513001507": 17, "s1": 7, "s100a11": 15, "s100a9": 5, "s11_aaacctgagattaccc": 3, "s11_aaacctggtaattgga": 3, "s11_aaacctggtagcacga": 3, "s11_aaacctggtctcaaca": 3, "s11_aaacctgtcgccgtga": 3, "s11_aaacctgtcttatctg": 3, "s11_aaacgggcaagaaagg": 3, "s11_aaacggggtagcgatg": 3, "s11_aaacggggtcggcact": 3, "s11_aaacggggttacggag": 3, "s12064": 7, "s12276": 50, "s12859": [13, 14, 23], "s12864": 50, "s12_tttggttgtcagaggt": 3, "s12_tttggtttcaagaagt": 3, "s12_tttggtttctactatc": 3, "s12_tttggtttctcgcttg": 3, "s12_tttgtcacacggtaga": 3, "s12_tttgtcagtagaaagg": [3, 4], "s12_tttgtcagtccaacta": [3, 4], "s12_tttgtcagtgagtgac": [3, 4], "s12_tttgtcatccactcca": [3, 4], "s12_tttgtcatcgcatgat": [3, 4], "s13059": [5, 6, 7, 11, 14, 16, 17, 19, 23, 24, 25, 28, 30, 32, 33, 34, 41, 48, 50, 51], "s13073": 2, "s1672022921000486": 24, "s1d1": [7, 8, 26, 27, 28, 48], "s1d2": [7, 26, 27, 28, 48], "s1d3": [7, 26, 27, 28, 48], "s2001037021000192": 5, "s2001037023000156": 39, "s2405471216303313": 24, "s2405471219302698": 5, "s2405471220304592": 34, "s2452310021000081": 25, "s2667237522000376": 9, "s2_fsv": 41, "s2_logdelta": 41, "s2d1": [7, 26, 27, 48], "s2d4": [7, 26, 27, 48], "s2d5": [7, 26, 48], "s3": [2, 21], "s35": 1, "s3d1": 48, "s3d10": [7, 26], "s3d3": [7, 26], "s3d6": [7, 26, 48], "s3d7": [7, 26, 48], "s41421": 38, "s41467": [5, 9, 13, 14, 16, 17, 24, 25, 31, 41, 47, 51], "s41576": [9, 25, 30, 39], "s41586": [5, 23, 24, 25, 36, 49, 50, 51], "s41587": [5, 7, 13, 16, 17, 23, 24, 27, 36, 48, 50, 51], "s41588": [9, 16], "s41589": 49, "s41591": [5, 7], "s41592": [2, 5, 7, 9, 19, 22, 25, 27, 28, 33, 36, 37, 38, 40, 41, 44, 49, 50, 51], "s41596": [16, 24, 25], "s41598": [5, 6, 23, 25, 50], "s42003": [36, 39, 41], "s43586": 50, "s44": 1, "s4d1": [7, 26, 48], "s4d8": [7, 11, 26, 48], "s4d8_cluster": 5, "s4d8_dimensionality_reduct": 31, "s4d8_feature_select": [31, 32], "s4d8_normal": [32, 33], "s4d8_quality_control": [33, 34], "s4d8_subset_gex": 6, "s4d9": [7, 26, 27, 48], "s4vector": [7, 21], "s4vectors_0": [8, 15, 25, 27, 28], "s_": 38, "s_c": 33, "s_g": 51, "s_score": 51, "sa": 4, "sabrina": [19, 29, 37, 40, 41], "sacrif": 1, "sadekova": 48, "sadi": 49, "saeb": 5, "saec": 2, "saei": [25, 50], "saelen": [25, 50], "saeyslab": 25, "saez": [15, 25, 26, 36], "safe": 24, "safer": 24, "sagar": 24, "sage": 7, "sagenet": 5, "sagiv": 4, "saglam": [17, 26], "sahand": 49, "sai": [7, 8, 11, 15, 17, 21, 23, 26, 38], "said": [1, 5], "saidi": 25, "saiful": [23, 24, 50], "saitou": 49, "sakaguchi": [48, 50], "sake": [13, 19, 25], "saket": 27, "salathia": 15, "salcher": 13, "salgado": 26, "saliba": [14, 17, 26, 50], "salinno": 51, "salmon": 23, "salmon_alevin": 23, "salmon_index": 23, "salmonella": 13, "salomoni": 23, "salom\u00e9": 13, "salvador": 49, "sam": [18, 23, 25, 34, 50], "samakovli": 5, "samantha": [2, 16, 23, 49], "samaran": [7, 38], "samarendra": 14, "samd9l": 25, "same": [1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 41, 43, 46, 48, 49, 50], "samit": 9, "sampl": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 16, 18, 19, 21, 23, 24, 25, 27, 28, 32, 33, 34, 36, 37, 38, 39, 41, 44, 45, 46, 49, 50], "sample_col": [13, 25], "sample_color": 14, "sample_condition_ind": 15, "sample_count": 13, "sample_id": [3, 11, 37], "sample_identifi": 13, "sample_kwarg": 36, "sampleid": [17, 49], "samplemap": 21, "samplenam": [7, 27, 28], "samra": 49, "samtool": 23, "samuel": [5, 7, 14, 17, 23, 38, 49], "san": [7, 8], "sanada": 24, "sancho": 25, "sandberg": [23, 24], "sandbox": [7, 11, 27, 28, 34, 48], "sandeep": 4, "sander": [16, 17, 26], "sandrin": [14, 50], "sandu": 2, "sane": [23, 24], "sanger": [5, 24, 38], "saniti": [3, 13], "sanja": 38, "sanjai": 16, "sanjana": 16, "sankaran": [48, 50], "santiago": [15, 23, 49], "santo": 26, "sanz": 2, "sapien": 4, "sapirstein": 49, "sappli": 8, "sar": [2, 3, 4, 7], "sara": [2, 5, 8, 9, 11, 15, 24, 26, 49, 51], "sarada": 24, "sarah": [2, 7, 9, 13, 17, 24, 25, 37, 41, 49, 50], "sarin": 3, "sarita": 36, "sarkar": [23, 37, 51], "sarkin": [36, 50], "sarkozi": 5, "sasagawa": 24, "sascha": [15, 24], "sasha": [14, 15, 16, 25], "satellit": 11, "satija": [5, 7, 9, 14, 15, 16, 19, 23, 24, 27, 28, 47, 48, 50], "satijalab": [16, 27, 28], "satisfactori": 49, "satisfi": [15, 23], "satoko": 5, "satpathi": 3, "sattler": 36, "sauer": [15, 24], "saunder": 16, "save": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "save_d3_html": 8, "save_d3_png": 8, "save_path": 3, "save_path_dir": 11, "saverd": [8, 28], "saw": [5, 7, 9, 10, 21], "sawitzki": [17, 26], "sayan": 15, "sayantan": 23, "sb": 4, "sb19": 2, "sbz": 4, "sc": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 19, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "sc_gene": 17, "sc_toolbox": 14, "sca": [5, 14], "scaden": 17, "scaffold": 9, "scalabl": [5, 9, 13, 14, 15, 19, 21, 23, 27, 29, 37, 38, 40, 41, 48, 49, 50], "scale": [1, 2, 4, 5, 6, 7, 8, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 27, 29, 33, 36, 37, 38, 39, 41, 47, 49, 50, 51], "scale_adversarial_loss": 27, "scale_color_gradientn": 8, "scale_color_manu": 8, "scaled_weight": 25, "scaledata": [27, 28], "scales_1": [8, 25, 27, 28], "scales_count": 33, "scalia": 38, "scanorama": 7, "scanpi": [1, 2, 3, 4, 5, 6, 7, 11, 13, 14, 15, 16, 17, 18, 21, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "scanvi": 7, "scar": 49, "scarch": [5, 27], "scarches_model": 5, "scatac": [7, 8, 9, 10, 11, 22, 48], "scatac_pipelin": 10, "scatac_pp": 11, "scater": 34, "scatter": [1, 7, 8, 11, 13, 16, 23, 34, 36, 37, 46, 49, 50, 51], "scatter_kw": 14, "scattermor": [7, 21], "scattermore_0": [25, 27, 28], "scatterplot": [1, 7, 13, 16, 25, 28, 32, 36, 40, 44], "sccoda": [13, 14], "sccoda_data": 13, "sccoda_model": 13, "sccoda_param": 13, "sccoda_sample_id": 13, "sccolor": 24, "scd": 23, "scdata": 17, "scdatamatrix": 17, "scdbl_result": 11, "scdblfinder": [11, 31, 32, 33, 34], "scdblfinder_class": [31, 34], "scdblfinder_scor": [11, 31, 34], "scdblfinder_scores_": 11, "scdc": [13, 17], "scdecaf": 15, "scdoubletfind": 11, "sce": [8, 11, 21, 32, 34], "sce2anndata": 21, "sce_from_seurat": 21, "sceasi": 21, "sceasy_seurat": 21, "scenario": [7, 8, 13, 16, 19, 26, 27], "scenic": 15, "scenicprotocol": [8, 26], "scetosinglecellassai": 14, "scflow": [19, 29], "scgco": 41, "scgen": 7, "scgestalt": 49, "scglue": [27, 28], "scgluemodel": 27, "scgluetrain": 27, "sch": 14, "schaar": [6, 8, 11, 19, 26, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48], "schalck": 49, "schapiro": 36, "schattgen": 3, "schatz": 1, "schaub": 25, "schechter": 49, "scheibner": 51, "schema_vers": 36, "schemat": 2, "schep": 8, "scherer": 17, "scheuermann": 24, "schiebing": 49, "schier": [7, 49], "schierenberg": 49, "schiller": [5, 7, 50, 51], "schillerlab": 14, "schirg": 51, "schist": 13, "schleiden": 24, "schlesing": 23, "schlickeis": [17, 26], "schmidt": 23, "schmitz": 13, "schnall": [23, 24], "schneider": [7, 11, 17, 25, 26, 27, 28, 34, 36, 48], "schnell": 23, "schnier": [5, 7, 50, 51], "schoettl": 2, "schork": 24, "schrep": [17, 26], "schroeder": [37, 41], "schubert": [3, 13, 15], "schuldt": 2, "schuller": 16, "schult": [17, 26], "schultz": [5, 7, 17, 26, 50], "schulz": [17, 23, 26], "schumach": 36, "schupp": [7, 25], "schurger": 36, "schwann": 24, "schwartz": [17, 23], "sch\u00e4fer": [5, 36], "sch\u00fcbeler": 9, "sci": [17, 23, 26, 43, 49], "sciadv": [17, 25, 51], "scialdon": 14, "scib": [7, 27], "scib_anndata": 28, "scienc": [0, 1, 4, 5, 9, 13, 14, 15, 16, 17, 18, 19, 24, 25, 27, 28, 30, 34, 39, 40, 48, 49, 50, 51], "sciencedirect": [5, 9, 17, 24, 27, 28, 34, 39, 40], "sciencemag": 25, "scientif": [5, 6, 23, 24, 25, 50], "scientist": [24, 30, 49], "scikit": [7, 15, 19, 25], "scipi": [1, 4, 5, 7, 15, 17, 19, 21, 25, 28, 33, 34, 41, 48], "scirpi": [1, 2, 3, 4, 19], "sclerosi": [5, 14], "scnaumi": 24, "scnt": 50, "scope": [3, 4, 19, 25, 30], "score": [3, 4, 5, 6, 7, 8, 13, 14, 16, 17, 18, 23, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 40, 49, 51], "score_col": 14, "score_small_parsimoni": 49, "scott": [4, 5, 7, 11, 13, 15, 17, 23, 27, 28, 34, 48], "scplastic": 49, "scpregan": 16, "scran": [5, 6, 15, 31, 32, 33, 34], "scran_norm": [5, 32, 33], "scratch": 7, "scratchpad": 49, "screen": [4, 25], "screpertoir": [2, 4], "script": [3, 8, 17, 19, 42], "scrna": [2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 26, 27, 31, 32, 33, 34, 36, 38, 44, 47, 48, 49, 50, 51], "scrnaseq": 23, "scroll": 5, "scrublet": 23, "scry": [31, 32, 33, 34], "scseqcomm": 25, "scslam": 50, "sct": 27, "sctransform": [6, 7, 15, 21, 27, 31, 32, 33, 34], "sctransform_0": [25, 27, 28], "scuttl": 21, "scv": 51, "scvelo": 51, "scvers": [2, 5, 13, 16, 18, 19, 21], "scvi": [5, 7, 13, 16, 18, 21, 27, 28, 36, 44, 49], "sd": [13, 23], "sdc3": 38, "se": [1, 8, 23, 41], "seaborn": [1, 4, 5, 7, 11, 13, 14, 15, 25, 26, 28, 32, 33, 34, 38, 44, 48], "sean": [4, 19, 22, 24, 34, 50], "search": [2, 3, 4, 23, 37, 49, 50], "search_l": 37, "search_r": 37, "sebastiaan": 2, "sebastian": [1, 3, 9, 40], "sec": 8, "second": [1, 4, 5, 11, 13, 15, 17, 19, 21, 27, 33, 36, 37, 38, 40, 50], "secondari": [4, 14], "secondli": [34, 47], "secret": [5, 25], "section": [0, 3, 7, 9, 13, 14, 15, 16, 17, 19, 22, 23, 25, 27, 28, 30, 33, 34, 36, 37, 49], "see": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 36, 37, 38, 40, 41, 44, 45, 46, 47, 48, 49, 50], "seeberg": 23, "seed": [7, 8, 24, 25, 27, 28, 34, 36], "seek": [23, 30, 49], "seem": [5, 11, 13, 14, 16, 25, 33, 36, 38, 40, 41, 49], "seemingli": 0, "seen": [1, 3, 7, 9, 14, 33, 34, 43, 44, 45], "sefik": 13, "segerstolp": 38, "segfault": [7, 21, 27, 28], "segment": [2, 16, 18, 23, 24, 38, 39], "segreg": 23, "sei": 49, "seibold": [5, 7, 50], "seldom": 40, "select": [1, 3, 4, 5, 6, 8, 11, 13, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 29, 31, 33, 34, 36, 38, 40, 41, 45, 47, 48, 50], "select_slid": 36, "select_variance_featur": 16, "selected_cel": 17, "selectintegrationfeatur": 7, "selectmodel": 8, "self": [1, 2, 4, 15, 27], "self_loop_prot": 27, "self_loop_rna": 27, "self_reported_ethn": 36, "sell": 27, "semant": 19, "semi": [7, 17, 23], "semir": [13, 22], "send2trash": [1, 21], "sender_celltyp": 25, "sender_express": 25, "senkamp": [17, 26], "sens": [5, 7, 14, 15, 19, 21, 23, 38], "sensibl": [11, 36], "sensit": [5, 7, 9, 13, 14, 15, 16, 23, 24, 29, 32, 34, 36, 39, 44], "sent": [2, 4, 49], "seo": 23, "seohyon": 34, "seok": 49, "seong": [47, 48], "sep": [2, 4, 5, 10, 14, 16, 17, 25, 26, 34, 47, 48, 49], "sepal": 41, "separ": [1, 2, 3, 5, 7, 11, 13, 14, 15, 16, 17, 18, 19, 22, 23, 24, 25, 26, 27, 28, 31, 33, 43, 44, 48, 49], "seper": 10, "septemb": [7, 8, 11, 23, 32, 33, 34, 36, 41, 50, 51], "seq": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 26, 27, 30, 31, 32, 33, 34, 36, 37, 38, 39, 44, 47, 48, 49, 50, 51], "seq2": [2, 24], "seq3": 23, "seq_field": 1, "seqeunc": 4, "seqfish": [5, 38, 39], "seqlevelsstyl": 10, "seqlogo_1": 8, "seqnam": 8, "seqs_background": 3, "seqs_elev": 3, "sequenc": [0, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 22, 25, 26, 28, 29, 30, 31, 33, 34, 36, 38, 40, 43, 47, 48, 49, 50, 51], "sequence_align": 1, "sequence_id": 1, "sequencecolumn": 1, "sequenti": [8, 27, 28, 49, 50], "seqv2": 39, "sergei": [5, 19, 37, 40, 41], "serghei": 17, "sergio": [7, 17], "sergushichev": 15, "seri": [1, 13, 14, 17, 23, 26, 47, 49], "serial": 19, "serialis": 21, "serif": 7, "seriou": 24, "serra": 25, "serv": [3, 8, 9, 19, 24, 25, 26, 30, 38, 49], "server": [5, 15], "sesn3": 8, "session": [1, 8, 28, 31, 32, 33, 34], "session_info": [1, 6, 7, 15, 16, 21, 25, 49], "sessioninfo": [7, 8, 15, 21, 25, 27, 28], "set": [1, 2, 3, 4, 6, 7, 8, 9, 10, 11, 13, 14, 17, 18, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "set1": 11, "set_attribut": 49, "set_axi": 7, "set_fdr": 13, "set_figure_param": [1, 5, 6, 15, 16, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 51], "set_index": [5, 11, 15, 25, 28, 36], "set_l": 37, "set_palett": 11, "set_styl": 11, "set_titl": [11, 13, 33, 38], "set_vis": 4, "set_xlabel": [14, 26, 38], "set_xlim": [7, 32], "set_ylabel": [14, 26, 38], "set_ylim": [7, 11, 32], "set_yticklabel": 1, "setclust": 34, "setdiff1d": 49, "seth": 50, "setlevel": [14, 27, 28, 32, 33, 34], "setsoupprofil": 34, "sett": 4, "setti": [50, 51], "settings_embed": 3, "settings_ful": 3, "settingwithcopywarn": [1, 21], "setup": [1, 2, 3, 4, 6, 7, 8, 11, 13, 16, 19, 21, 23, 31, 32, 33, 36, 38, 43], "setup_10x_for_conga": 3, "setup_anndata": [7, 13, 16, 27, 28, 36], "setuptool": [7, 15, 25], "setuptools_scm": [1, 25], "seung": 40, "seurat": [5, 7, 14, 16, 17, 19, 25, 26, 28, 34], "seurat_4": [25, 27, 28], "seurat_clust": [14, 15, 16, 25], "seurat_covid19_freshwb_pbmc_cohort2_incl_raw": 17, "seurat_from_sc": 21, "seurat_h5mu_fil": 21, "seurat_v3": 15, "seuratdisk": 21, "seuratobject": [7, 21], "seuratobject_4": [25, 27, 28], "seven": [16, 24], "sever": [2, 3, 4, 5, 7, 8, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 26, 28, 30, 31, 33, 34, 38, 39, 40, 41, 45, 47, 49, 50, 51], "sex": [2, 5, 11, 17, 36], "sey": 14, "sf": [21, 36], "sfdp": 1, "sforza": 49, "sg": 36, "sgc": 3, "sgener": 8, "sgrna": 16, "sh": 47, "sha": 37, "sha256": 2, "shacknei": 17, "shadow": 42, "shah": [5, 14], "shahrezaei": 24, "shai": 17, "shaina": 24, "shaista": 27, "shalek": [14, 23, 24, 25, 49], "shalini": [3, 4], "shall": 49, "shane": 2, "shankar": 24, "shannon": [19, 22], "shanshan": 49, "shape": [1, 3, 5, 8, 14, 15, 17, 19, 25, 26, 27, 32, 33, 34, 46, 49, 51], "shape_1": [8, 25], "shapovalova": 24, "sharan": 49, "share": [1, 2, 3, 4, 7, 8, 9, 13, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 30, 36, 38, 49, 50, 51], "shared_featur": 36, "shared_hidden": 3, "sharei": 38, "sharma": [3, 4], "shaul": 36, "shaun": [2, 24], "shawn": 49, "shc014": 4, "shea": 7, "sheana": 24, "sheer": 23, "sheet": 23, "shehata": 24, "sheida": 14, "shekhar": [13, 22, 23, 24], "shell": 4, "shelli": [7, 11, 27, 28, 34, 48], "shen": [16, 17, 37], "shendur": [5, 23, 49], "sheng": 24, "shengqi": 39, "shennor": 17, "shepherd": [5, 7, 50], "sheppard": [5, 7, 50], "sheri": [3, 4], "sheridan": 5, "sherman": [38, 49], "sheryl": [7, 11, 27, 28, 34, 48], "shesh": 14, "shi": [5, 7, 13, 14, 15, 22], "shian": 23, "shiau": 9, "shibin": 49, "shifrut": 4, "shift": [1, 3, 4, 7, 13, 16, 18, 25, 31, 34, 36], "shigeki": 49, "shiji": [37, 51], "shila": [7, 51], "shim": 26, "shimon": [48, 50], "shin": [1, 7, 26], "shina": 49, "shini": [7, 21, 23], "shinohara": [37, 41], "shiny_1": [8, 25, 27, 28], "shipe": 37, "shiquan": 41, "shiwei": [5, 14, 16, 19, 27, 28], "shiyi": 34, "shiyu": 4, "shiyuan": 31, "shlomchik": 1, "shm": 49, "shmatko": 36, "short": [2, 4, 18, 23, 24, 25, 40, 49], "shortcom": [21, 24, 38], "shorten": 14, "shorter": [1, 24], "shorthand": 19, "shortli": [19, 37, 39], "shou": [17, 49], "should": [1, 2, 3, 4, 5, 7, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 28, 29, 34, 36, 38, 40, 41, 45, 49, 50, 51], "shoulder": 0, "shouldn": 7, "show": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 48, 49, 50], "show_img": 36, "show_leaf_effect": 13, "show_legend": 13, "show_method": 25, "show_row_dend": 8, "showcas": [2, 3, 4, 5, 9, 10, 11, 25, 26, 27, 28, 34, 38, 39], "shown": [1, 2, 3, 4, 5, 7, 8, 9, 11, 14, 17, 19, 21, 23, 24, 25, 36, 51], "shpak": 15, "shred": 1, "shrubsol": 50, "shrunken": 14, "shruti": 16, "shtokalo": 16, "shu": [7, 39, 49], "shuai": 37, "shuer": 24, "shuffl": [14, 25, 27], "shuga": [23, 24], "shugai": 4, "shun": [48, 50], "shuo": 2, "shuqiang": 24, "shuxiong": 25, "shvet": 43, "shyamal": 13, "sickl": 24, "side": [5, 14, 23, 42, 49], "sidelin": 9, "sieber": 15, "sieghart": 13, "sierra": 23, "sift": 49, "sig": [13, 36], "sign": [2, 5, 14, 15, 16, 25, 27, 50], "sign_thr": 25, "signac": [9, 10], "signal": [1, 2, 5, 7, 9, 15, 16, 18, 23, 24, 26, 27, 28, 34, 36, 38, 41, 43, 48], "signatur": [2, 3, 15, 17, 36], "signedhead": 2, "signific": [7, 11, 13, 14, 15, 16, 17, 23, 25, 30, 41, 47, 48], "significantli": [13, 14, 15, 23, 41], "sijia": 7, "sikand": 36, "sikkema": [5, 7, 50], "silenc": [3, 9], "silhouett": [7, 28, 37], "silhouette_": 28, "silico": [16, 23, 49], "silvia": [49, 51], "sim": [5, 23, 36, 38], "sim_r": 23, "sim_result": 13, "simd": 23, "similar": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 28, 31, 32, 33, 34, 36, 37, 38, 40, 43, 44, 45, 48, 49, 50, 51], "similarli": [2, 3, 4, 5, 13, 14, 16, 19, 23, 25, 34, 43, 49, 50, 51], "simmon": 24, "simon": [2, 5, 6, 14, 15, 16, 19, 22, 23, 24, 25, 40, 49, 50], "simpl": [5, 7, 13, 15, 16, 17, 19, 23, 24, 25, 33, 34, 38, 40, 49, 51], "simple_pca": 19, "simpleaf": 23, "simpleaf_index": 23, "simpleaf_qu": 23, "simplefilt": [1, 2, 3, 5, 13, 16], "simplelist": 21, "simpler": 21, "simplest": [23, 25, 36], "simpli": [3, 5, 13, 15, 16, 17, 19, 23, 33, 34, 36, 37, 45, 47], "simplic": [2, 7, 15, 25, 51], "simplif": [19, 23], "simplifi": [10, 36], "simul": [7, 11, 13, 15, 16, 19, 36, 49], "simultan": [3, 14, 16, 17, 18, 19, 21, 24, 26, 27, 28, 47, 48, 49, 50], "sin": 5, "sina": [23, 51], "sinc": [2, 3, 4, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 27, 28, 34, 36, 37, 40, 41, 45, 47, 48, 49, 51], "sinfo": [1, 25], "singecellexperi": 14, "singer": 49, "singh": [2, 23, 24], "singl": [0, 1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 18, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 40, 41, 44, 47, 48, 49, 50, 51], "singlecellassai": 14, "singlecellexperi": [7, 11, 14, 15, 21, 27, 28, 33, 34], "singlecellexperiment_1": [8, 15, 27, 28], "singlecellexperimentobject": 21, "singlecellsignalr": 25, "singlet": [11, 34], "singleton": [1, 6, 17], "singular": [7, 11, 16], "sinha": 7, "sini": 14, "sinlg": 2, "sinu": 4, "siong": 7, "sir": [17, 26], "sirna": 18, "sisi": 23, "sister": 49, "sit": [7, 23], "site": [1, 2, 3, 4, 5, 6, 7, 9, 11, 15, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 34, 36, 37, 41, 48, 49, 50], "site2_donor1_cit": 27, "site2_donor1_multiom": 27, "site2_donor4_cit": 27, "site2_donor4_multiom": 27, "site4": [5, 6], "site_color": [27, 28], "situ": [25, 38, 40, 49], "siv": 4, "six": [1, 7, 15, 21, 23, 25], "siyan": 49, "siyuan": 38, "size": [1, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 17, 18, 19, 21, 24, 25, 26, 27, 33, 34, 36, 37, 39, 40, 41, 42, 50, 51], "size_by_donor": 14, "size_factor": [27, 33], "size_factor_kei": 7, "size_of_subtre": 49, "size_pow": 4, "size_rang": 25, "sizefactor": 33, "skaug": 14, "skene": [14, 19, 29], "skeptic": 23, "sketch": 23, "skew": [13, 23], "skewnorm_ufunc": 25, "ski": 7, "skill": 30, "skinnid": [14, 16], "skip": [16, 17, 21, 23, 36], "sklearn": [1, 7, 15, 19, 21, 25, 38, 44], "skmisc": 15, "skum": 14, "slab": 28, "slamf6": 27, "slamf7": 27, "slc16a6": 8, "slc17a7": 41, "slc25a37": [5, 12, 26], "slc2a9": 8, "slc4a1": [5, 12, 26], "slice": [1, 18, 19, 21, 24, 36], "slichter": 14, "slide": [36, 37, 39, 40, 41], "slightli": [1, 3, 5, 7, 13, 43], "slimmer": 28, "slingshot": 50, "sloan": 24, "slot": [7, 11, 16, 19, 21, 28, 51], "slow": [29, 49], "slower": 49, "slowikowski": [7, 44], "slowli": [5, 29], "slug": 50, "slurm": 36, "slyper": [7, 50], "smad7": 8, "small": [0, 1, 2, 5, 7, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 28, 32, 34, 48, 49, 50, 51], "smaller": [2, 5, 13, 15, 16, 23, 24, 34, 36, 37, 39], "smart": [2, 24], "smear": 14, "smet": 24, "smfish": 38, "smibert": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "smilli": [7, 13, 22], "smit": 24, "smita": [7, 11, 13, 16, 27, 28, 34, 48], "smith": [7, 22, 23, 24, 49, 51], "smoker": 2, "smoland": 14, "smooth": [8, 16, 37, 51], "smoothscor": 8, "smoothscoresnn": 8, "smriti": 9, "smudg": 23, "smyth": [14, 15, 19, 22, 37], "sn": [5, 11, 13, 14, 25, 26, 28, 32, 33, 34, 38, 44, 48], "sn87": 49, "snakemak": 21, "snapatac": 9, "snapshot": [13, 24, 50, 51], "sne": [45, 50], "sniffio": [1, 21], "snippet": 8, "snir": 2, "snow_0": 8, "snp": 34, "snr": 18, "snrna": [11, 18, 23, 24, 27, 36, 38], "snyder": 50, "so": [1, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 17, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 36, 39, 41, 46, 48, 49, 50, 51], "societi": [13, 14, 49], "sock": 21, "socorro": 26, "socs1": [14, 25], "soen": 51, "soeren": 7, "sofi": 2, "soft": 23, "soften": 51, "softwar": [2, 7, 9, 11, 19, 23, 26, 34, 49], "soh": 49, "sohrab": [5, 14], "soichiro": 49, "sok58": 49, "sokal": 49, "sola": 23, "solana": [6, 50], "solar_extra": 8, "soldatov": [50, 51], "sole": [16, 19, 48], "solexa": 24, "solid": [16, 24, 30], "sollid": 2, "solo": 23, "solomon": 49, "solongo": [23, 24], "solubl": 2, "solut": [2, 9, 11, 13, 14, 15, 22, 23, 24, 34], "solv": [13, 17, 18, 36, 49], "solver": 49, "somaraki": 14, "somat": [1, 2, 4, 49], "some": [0, 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 46, 49, 50, 51], "someid": 50, "someid0001": 50, "someth": 7, "sometim": [5, 7, 11, 21, 23, 24, 34, 50], "somewhat": 23, "somewher": 7, "son": 24, "sonal": 9, "sonali": 23, "soneson": [6, 14, 22, 23, 51], "song": [15, 26], "sonia": 49, "sonja": 15, "sonrel": [32, 33, 34], "sontak": 5, "soomin": 49, "soon": [9, 29], "sophi": 51, "sophia": [15, 17, 26], "sophist": [16, 23, 45, 49], "sopper": 13, "soraya": 24, "sorcha": 50, "soroor": [14, 15], "sort": [2, 3, 4, 8, 13, 14, 15, 16, 17, 23, 24, 32, 41, 44], "sort_ord": 5, "sort_valu": [5, 14, 15, 16, 17, 25, 26, 41, 49, 51], "soufian": 38, "soumya": [5, 7, 44], "sound": [11, 13, 21, 29], "sountoulidi": 7, "soup": 34, "soupchannel": 34, "soupprof": 34, "soupx": [23, 31, 32, 33, 34], "soupx_count": 34, "soupx_group": 34, "souquett": [3, 4], "sourc": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 28, 30, 36, 49, 50], "source_label": 25, "sources_loc": 50, "sox17": 38, "sox6": 26, "sp": [4, 7, 21], "sp_1": [25, 27, 28], "space": [1, 2, 3, 5, 6, 7, 13, 14, 16, 17, 18, 19, 23, 27, 28, 29, 31, 34, 36, 37, 40, 41, 43, 49, 50], "spagcn": [36, 38, 40, 41], "spagcn_domain": 37, "spage": 38, "spain": 42, "span": [2, 13, 16, 23, 31, 50], "spanjaard": [7, 49], "spark": 41, "spars": [1, 3, 4, 5, 7, 9, 11, 13, 15, 18, 19, 21, 24, 26, 28, 31, 33, 34, 38, 43, 47, 48, 49, 51], "sparse_3": [25, 27, 28], "sparsematrix": [8, 34], "sparsematrixstats_1": 8, "sparsiti": [5, 11, 38], "sparsity_diff": 38, "sparsity_sc": 38, "sparsity_sp": 38, "spata2l": 41, "spatial": [4, 7, 13, 18, 19, 21, 22, 24, 25, 30], "spatial_autocorr": 41, "spatial_connect": [37, 40, 41], "spatial_dist": [37, 40, 41], "spatial_neighbor": [37, 40, 41], "spatial_scatt": [36, 37, 41], "spatialaba": 36, "spatialal21": 41, "spatialammr20": 38, "spatialbsb": 38, "spatialclc": 37, "spatialcmz": 36, "spatiald": [36, 37, 38, 40], "spatialde2": 41, "spatialdwl": 36, "spatialdzd": 37, "spatialebnm": 36, "spatialfdr": 13, "spatialgfgd10": 40, "spatialhlc": [37, 41], "spatialkrfl": 36, "spatialksd": 36, "spatialkvts21": 41, "spatiallli": 38, "spatialllk": 36, "spatiallnl": 38, "spatiallzg": [36, 38], "spatialmlh22": 39, "spatialpsk": [37, 40, 41], "spatialptx": 37, "spatialsts18": 41, "spatialszz20": 41, "spatialthd": 40, "spatialwcr": [39, 41], "spatialylh": 39, "spatialzfw22": 41, "spatialzsr": 37, "spatialzsz21": 41, "spatiotempor": 37, "spatstat": [7, 21, 25, 27, 28], "spbks22": 48, "spca": [27, 28], "speak": [24, 30, 51], "spec": 7, "spec_weight": 25, "speci": [1, 4, 7, 15, 23, 26, 34, 49], "special": [2, 17, 18, 19, 21, 23, 24, 25, 49], "species_align": 4, "species_fullir": 4, "species_manu": 4, "species_vj": 4, "specif": [1, 2, 3, 5, 6, 7, 8, 9, 10, 11, 13, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 28, 30, 31, 32, 34, 38, 41, 43, 46, 47, 48, 49, 50, 51], "specifi": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "specificity_rank": 25, "specimen": 38, "spectratyp": 3, "spectrometri": 29, "spectrum": 13, "speed": [3, 5, 11, 14, 16, 23, 24], "spenc": 5, "spg": 37, "sphinxcontrib": 7, "spieckermann": 40, "spielmann": 23, "spike": [18, 23, 24, 28], "spindl": 24, "spitz": 8, "spitzer": [19, 37, 40, 41], "spkmf": 44, "splba16": 48, "splbc": 48, "splic": 23, "splice": [2, 18, 21, 24, 50, 51], "splici": 23, "splici_ref": 23, "splici_rl90_ref": 23, "splines_4": [8, 25, 27, 28], "split": [7, 10, 13, 14, 15, 19, 23, 27, 28, 38, 40, 44, 48, 49], "split_assay_nam": 10, "split_bi": 16, "splitobject": 7, "splrc": 44, "spmlc": 48, "spoken": 39, "spon2": 12, "spot": [13, 15, 36, 37, 38, 39, 40], "spot_siz": 38, "spotlight": 36, "sppzk": 48, "spread": [15, 19, 36, 37], "springer": [4, 15], "springer2021contribut": 4, "sprwyfyyl": 4, "spsbeo": 48, "spsh": 48, "spuriou": 23, "spxd22": 48, "spyro": 24, "spzjt": 48, "sq": [36, 37, 40, 41], "sqe": 9, "squair": [14, 16], "squar": [4, 14, 50], "squareform": 4, "squidpi": [5, 19, 36, 38, 40], "squidpy_domain": 37, "squish": 8, "srb": [1, 2], "src": 10, "srcb": 24, "srivastava": [5, 9, 14, 19, 23, 27, 28, 51], "srivatsan": 16, "srollah": 14, "srun": 36, "ssbp2": [5, 12], "ssf": 2, "ssgsea": 15, "sspn": [5, 12], "sst": 49, "sswt83": 49, "st": [24, 36], "stab2": 38, "stabil": [2, 15, 31, 33, 34, 41], "stabl": [1, 5, 6, 15, 18, 19, 21, 49, 50], "staci": 49, "stack": [1, 13, 19, 27, 48], "stack_data": [7, 15, 21, 25], "stackedbarplot": 1, "stadler": 23, "stage": [3, 5, 6, 7, 9, 21, 23, 24, 48, 49, 50], "stai": [15, 27, 30], "stamataki": 14, "stamp": 24, "stanca": 1, "stand": 23, "standard": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 15, 17, 21, 23, 25, 26, 28, 29, 30, 32, 33, 36], "standard_scal": [5, 26], "stanfield": 4, "stanislav": 23, "stanlei": [13, 17], "star": [23, 34], "stark": 13, "starsolo": 23, "start": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 16, 17, 18, 19, 21, 23, 25, 26, 28, 29, 31, 32, 34, 36, 37, 40, 43, 47, 48, 49, 50], "startswith": [34, 36, 37, 49], "startup": [27, 28], "stat": [4, 7, 8, 14, 15, 17, 25, 27, 28, 34, 36, 48], "stat1": [15, 16], "state": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 24, 25, 26, 30, 34, 36, 37, 40, 49, 50], "state_to_indel": 49, "statement": 30, "static": [4, 23, 49, 50], "staticmethod": 28, "station": 2, "stationari": [2, 24], "statist": [3, 5, 6, 7, 13, 14, 15, 16, 21, 23, 25, 28, 29, 30, 33, 34, 36, 40, 41, 50], "statmod": [13, 15], "statmod_1": 15, "stats4": [8, 15, 27, 28], "stats4_4": 25, "statsmodel": [1, 7, 15, 19, 25], "statu": [1, 2, 7, 13, 17, 21, 23, 49], "status": 1, "status_df": 17, "status_on_day_collect": 2, "status_on_day_collection_summari": 2, "std": [21, 44], "stddev": 17, "stdout": 23, "stds_per_cluster_mu_fg": 36, "steadi": [18, 25], "steady_rank": 25, "steelman": [7, 11, 27, 28, 34, 48], "steemer": 23, "steen": 17, "steer": 38, "stefan": [2, 3, 13, 17, 23, 26, 49, 50, 51], "stefani": [23, 24, 49], "steffen": 51, "stegemann": [17, 26], "stegl": [7, 14, 15, 19, 24, 28, 36, 41, 48], "stegui": 5, "steidl": 5, "steier": [27, 28], "steiger": 40, "stein": [8, 9, 26, 51], "steiner": [17, 49], "stem": [1, 2, 3, 4, 5, 13, 24, 28, 38, 49, 50, 51], "sten": [23, 24, 50, 51], "step": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "stepanek": 43, "stephan": [14, 17, 23, 26], "stephani": [5, 14, 16, 19, 22, 23, 27, 28, 32], "stephen": [24, 26, 37], "stephenson": [1, 2, 16, 47, 48, 50], "ster": 14, "stereo": 39, "stern": 1, "sterr": [7, 11, 27, 28, 34, 48], "steven": [1, 2, 4, 7, 23, 24, 43, 50], "stg": 36, "stick": [2, 4, 11], "stijn": [7, 25], "still": [2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 16, 17, 19, 21, 23, 24, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 43, 44, 48, 49, 51], "stim": [14, 16, 25], "stim_fcgr3a": 15, "stim_kei": 16, "stimul": [1, 2, 3, 14, 25], "stimulated_b": 15, "stimulated_cd14": 15, "stimulated_cd8": 15, "stimulaton": 16, "stimuli": [1, 16, 24, 25, 51], "stimulu": 15, "stitzel": 11, "stl21": 4, "stlearn": 37, "stler": 51, "stmn1": 12, "stochast": [13, 18, 31, 49], "stoeckiu": [5, 7, 14, 16, 19, 27, 28, 47, 48, 50], "stone": [37, 50], "stop": [2, 5, 16, 18, 27, 28, 36, 37], "stopifnot": 8, "storag": [17, 18, 19, 21], "store": [1, 2, 3, 4, 5, 7, 13, 14, 15, 16, 17, 18, 21, 23, 24, 25, 28, 32, 34, 36, 37, 38, 40, 41, 45, 49, 50, 51], "storemag": 1, "str": [1, 2, 3, 4, 7, 13, 15, 17, 25, 26, 27, 34, 42, 43, 46, 48, 49], "str_split": 10, "straightforward": [1, 11, 14, 23, 36, 37], "strain": 15, "strand": [18, 23, 24], "stranger": 17, "strategi": [9, 14, 17, 23, 24, 30, 31, 34, 37, 49, 50, 51], "stream": [2, 26, 37, 49, 51], "street": [7, 27, 28, 50, 51], "strength": [3, 4, 13, 19, 21, 24, 25, 36], "strengthen": 5, "streptavidin": [2, 48], "stress": [7, 14, 24], "strict": [2, 13, 49], "strictconverg": 14, "stricter": 4, "strictli": 30, "strike": 16, "string": [1, 2, 3, 7, 15, 18, 19, 23, 34, 49], "stringent": [4, 16, 17, 48], "stringi": [7, 21], "stringi_1": [8, 25, 27, 28], "stringr": [7, 10, 21], "stringr_1": [8, 25, 27, 28], "strip": [15, 23, 26], "stripe": 23, "strive": 30, "strn3": 8, "strobl": [5, 7, 27, 28, 43, 44, 45, 46, 47, 48, 50], "stroke": 24, "strong": [1, 7, 8, 13, 16, 17, 18, 19, 21, 22, 24, 40, 42, 49], "stronger": [13, 16, 49], "strongest": 7, "strongli": [1, 8, 13, 14, 19, 24, 26, 34], "strsplit": 8, "structur": [2, 3, 4, 5, 6, 7, 8, 9, 15, 17, 18, 19, 21, 23, 24, 25, 28, 31, 33, 39, 40, 41, 49], "struggl": 13, "strunz": [3, 7], "stuart": [5, 7, 9, 14, 19, 27, 28], "stubbington": [2, 3], "student": [0, 14, 17, 31], "studi": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 17, 18, 19, 22, 23, 24, 26, 31, 41, 44, 45, 47, 48, 49, 50, 51], "study_id": 2, "study_nam": 3, "stuff": 30, "sturm": [2, 13, 19, 25], "style": [7, 13, 16, 26, 42], "su": [5, 15, 23], "suastegui": [7, 50], "sub": [3, 5, 6, 11, 17, 23, 26, 32, 34, 49], "subchapt": [14, 34], "subclon": 49, "subclust": 3, "subcort": 24, "subdivid": 5, "subfield": 30, "subgraph": 4, "subgroup": 17, "subject": [5, 7, 13, 14, 15, 19, 22, 23], "subject_id": 19, "subobject": 48, "subplot": [5, 7, 11, 13, 14, 25, 26, 33, 38], "subpopul": [7, 13, 14, 16, 34, 49], "subproblem": 49, "subramaniam": [14, 15, 16, 25], "subramanian": [7, 15, 38, 49], "subsampl": [3, 5, 13, 16, 34], "subsample_s": 16, "subsampled_summ": 15, "subsect": [3, 24], "subsequ": [5, 6, 11, 13, 18, 23, 24, 25, 31, 32, 33, 34, 36, 41, 48, 49], "subset": [1, 3, 4, 5, 7, 8, 13, 14, 15, 16, 17, 18, 21, 23, 26, 27, 28, 32, 36, 38, 41, 49, 51], "subset_nhood": 13, "subset_sampl": 13, "subsetcormus": 17, "subspot": 37, "substanti": [13, 15, 22, 23, 36], "substat": 6, "substitut": [1, 4, 18, 23, 24], "substr": 23, "substructur": [6, 49], "subtask": 7, "subtl": [7, 13], "subtract": [4, 16], "subtyp": [2, 4, 5], "subunit": 25, "success": [7, 15, 16, 17, 18, 21, 29, 36, 39, 48, 49, 50], "successfulli": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "successor": 24, "suchanek": 5, "sudberi": [23, 51], "suddenli": [16, 24], "suffer": [17, 24, 29, 31], "suffic": [7, 30], "suffici": [3, 4, 11, 13, 14, 23, 24, 25, 34, 51], "suffix": [4, 27, 43, 50], "suggest": [1, 3, 7, 9, 11, 15, 16, 17, 21, 23, 25, 26, 30, 44, 49, 51], "suguna": 24, "suit": [1, 3, 4, 15, 16, 22, 33, 34, 37, 49], "suitabl": [1, 11, 13, 16, 17, 23, 24, 31, 37], "suiter": 49, "sukhov": 15, "sullivan": [7, 24], "sulston": 49, "sum": [4, 5, 13, 14, 15, 17, 19, 21, 23, 25, 26, 27, 33, 34, 36, 38, 40, 41], "sum_": [36, 38], "sum_g": 33, "sum_i": 38, "sum_j": 38, "sumeer": 7, "summar": [3, 8, 11, 15, 19, 23, 26, 49], "summari": [3, 7, 13, 14, 23, 28, 30, 36, 40, 49], "summaris": 36, "summarize_tumor_qu": 49, "summarizedexperi": [7, 8, 19, 21], "summarizedexperiment_1": [8, 15, 27, 28], "summarizedexperimentobject": 8, "summary_metr": 16, "summarycond": 14, "summarydt": 14, "summat": 36, "sumner": 17, "sun": [5, 7, 25, 41, 48, 49, 50], "sundstr": [50, 51], "sung": 36, "sungnak": [1, 2], "sunil": [7, 11, 27, 28, 34, 48], "sunkin": 24, "sunmo": 26, "sunphil": 26, "suo": 50, "suoqin": 25, "superior": 14, "supervis": [3, 5, 7, 17, 23, 28], "supplement": 30, "supplement_2": 16, "supplementari": 36, "suppli": [7, 8, 11, 15], "support": [1, 2, 3, 5, 10, 11, 15, 18, 19, 21, 23, 24, 25, 26, 29, 30, 48, 49], "suppos": [23, 36], "suppress": [3, 16], "suppressmessag": 8, "suppresspackagestartupmessag": [11, 15, 25, 27, 28], "suppresswarn": 11, "suptitl": [4, 11], "sur": 15, "surani": 25, "sure": [5, 7, 10, 11, 13, 21, 23, 27, 28, 49], "surfac": [2, 16, 18, 19, 24, 28, 43, 44, 45, 46, 47, 48], "surpass": 3, "surpris": [2, 7, 24], "surround": [2, 5, 19, 23], "survei": [7, 13, 14, 22, 24], "surviv": [7, 21, 24], "survival_3": [8, 25, 27, 28], "susan": [24, 25, 49], "susann": [7, 36], "suscept": 15, "susi": 26, "susmelj": 16, "suspens": [2, 9, 24], "sustain": 18, "suttorp": [17, 26], "suzuki": 23, "su\u00e1stegui": [43, 44, 45, 46, 47, 48], "svd": [7, 11], "svd_solver": [19, 27, 31, 45], "svddc": 16, "svejnoha": 4, "svensson": [7, 24, 41], "svetlana": 48, "svg": [1, 3, 41], "svg_logo": [1, 3], "svgwrite": 1, "svoboda": 24, "swab_result": 2, "swain": 17, "swami": 7, "swanton": 49, "swap70": 8, "swap_ax": 14, "swapnil": 4, "swarbrick": 24, "swat": 5, "swati": [23, 24], "swell": 24, "swerdlow": [16, 47, 48, 50], "switch": [2, 4, 19], "sy": [3, 14, 15], "sycheva": 4, "sykora": 13, "sylvi": [5, 7], "sylvia": 36, "sym": 1, "symbol": [15, 17, 23, 26, 49], "symmetri": [4, 27], "symphoni": 5, "symposium": 50, "syndrom": [2, 50], "syne1": [5, 12], "syngr1": [5, 12], "synonym": [1, 49], "syntax": 13, "synthes": [18, 24], "synthesi": [18, 23, 24, 48], "synthet": [4, 18, 49], "system": [1, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "systemat": [5, 6, 17, 24, 25, 49], "szabo": [2, 5, 19], "szafer": 24, "szalai": 25, "szczurek": 14, "szymon": 14, "s\u00f6ren": 40, "t": [1, 2, 3, 4, 5, 7, 8, 11, 12, 13, 14, 15, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 41, 43, 44, 45, 46, 47, 48, 49, 50], "t23": 25, "t2g_3col": 23, "t6": 4, "t_stat": 15, "ta": 13, "taacttcagatacagt": 27, "taatt": 49, "tab": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "tab10": 11, "tab20c": 1, "tabaka": [49, 50], "tabib": [5, 7, 50], "tabix": 11, "tabl": [1, 2, 5, 7, 8, 11, 14, 15, 16, 21, 23, 24, 25, 26, 28, 34, 41, 45, 49], "table_1": [8, 25, 27, 28], "tacacgatcgggagta": 3, "tacaggtgttagagta": [27, 28], "tack": 25, "tackl": [13, 14, 16, 33, 36], "tadataka": 25, "tae": [1, 24], "taejeong": 49, "tag": [2, 3, 4, 11, 14, 16, 18, 23, 24, 27, 28, 34, 48], "tagment": [9, 24], "tagtggtagcgattct": 3, "tagwis": 14, "taha": [14, 16], "tail": [11, 23, 24, 26], "tailor": [22, 25, 47, 49], "taipal": 24, "tak": 26, "take": [1, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 24, 25, 26, 27, 28, 34, 36, 37, 38, 40, 41, 47, 48, 49, 51], "takeawai": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51], "taken": [1, 4, 7, 9, 13, 16, 19, 23, 50, 51], "takeshima": [48, 50], "tal": [4, 7, 9, 15, 17, 26, 28], "talaga": 24, "talavera": [5, 7, 50], "talk": [5, 21], "tallapragada": 24, "tallulah": 23, "tama": [2, 19], "tamara": [1, 24], "tamayo": 15, "tamili": 49, "tamim": [5, 38], "tamsyn": 47, "tan": [7, 15, 25, 37], "tanaka": [24, 49], "tandem": 49, "tanenbaum": 50, "tanevski": [15, 36], "tang": [2, 36, 38, 49], "tangram": [36, 37, 40, 41], "tangram_ct_pr": 38, "tansu": 9, "tantivit": 7, "tanya": 24, "tao": [3, 15, 25, 49], "tapsi": 49, "tar": [23, 49], "targ": [14, 15, 16, 25], "target": [1, 2, 3, 4, 7, 8, 13, 15, 16, 17, 18, 23, 24, 26, 33, 34, 38, 39, 48, 49], "target_col": [1, 2, 3], "target_gen": 16, "target_gene_id": 16, "target_label": 25, "target_num": 37, "target_sum": [5, 14, 25, 33], "tarjei": [23, 24], "tarqui": 51, "tasccoda": [13, 14], "tasccoda_data": 13, "tasccoda_model": 13, "tasic": 24, "task": [3, 7, 16, 17, 18, 23, 25, 26, 27, 28, 29, 30, 31, 33, 34, 36, 37, 38, 40, 41, 49], "tata": [5, 7, 50], "tatcaggagtgaacat": 3, "tatch": [7, 28], "tatgattagtcgcg": 49, "tatgattagtcgcgr1": 49, "tatgattagtcgcgr2": 49, "tatsuya": [48, 50], "tau": 15, "tauber": [17, 26], "taught": 30, "taylor": [1, 5, 7, 24, 25, 37, 40, 50], "tb01195": 13, "tb02031": 14, "tbb": 13, "tbi": 19, "tbl": 26, "tbrd2": 1, "tcacaaggtggtgtag": 3, "tcacctggttaggttg": 7, "tcaggcgatgcgaa": 49, "tccgaaaaggatcata": [27, 28], "tcf25": 41, "tcf4": [5, 12], "tcf7": [5, 12], "tcf7l2": [5, 12, 26], "tcgaagtgtgacaggt": 27, "tcgggaccagcatgag": 3, "tcm": 5, "tcr": [2, 19, 27, 43], "tcr_00_gex": 3, "tcr_00_read_align": [2, 3], "tcr_01_preprocess": [2, 3, 4], "tcr_clump": 3, "tcr_embed": 3, "tcr_filter": 1, "tcr_mergedupd": 2, "tcrb18": 1, "tcrdist": 3, "tcrdist3": 1, "tcrmatch_input": 4, "tcrmatch_output": 4, "tcrrep": 4, "tcrva7": 12, "tcrvd2": 12, "tcr\u03b2": 4, "tcttcctagccaaccc": 27, "teach": [22, 30], "team": [2, 5, 19], "tec": 8, "tech": 3, "technic": [5, 7, 9, 13, 14, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 32, 33, 36, 38, 43, 47, 48, 49], "technician": 23, "techniqu": [0, 3, 7, 8, 22, 23, 27, 31, 32, 33, 34, 41, 49, 50, 51], "technolog": [49, 50], "technologi": [3, 5, 7, 16, 17, 19, 21, 24, 27, 28, 31, 34, 36, 37, 39, 40, 50], "tedsim": 49, "teemu": 24, "teichmann": [2, 5, 7, 13, 24, 25, 41, 50], "tek": 38, "tel": 5, "tell": [1, 5, 7, 24], "tem": 5, "temesgen": 7, "temp": [25, 45, 46], "temp_dir": 21, "tempfil": 21, "templat": [2, 18, 24, 33], "tempor": [25, 49, 50], "temporari": [2, 5, 16], "temporarili": 11, "temporarydirectori": 21, "tempt": 7, "temra": 5, "ten": [1, 3, 8, 13, 24, 40, 48], "tend": [7, 11, 15, 17, 21, 23, 25, 49], "tendenc": 23, "tenenbaum": [19, 22], "teng": 14, "tensor": [7, 21, 25, 38], "tensor_1": [25, 27, 28], "tensorboard": 7, "tensorflow": 5, "terentyev": 16, "term": [1, 5, 6, 7, 8, 14, 15, 16, 19, 22, 23, 24, 26, 29, 31, 32, 33, 34, 36, 37, 38, 39, 41, 49, 51], "termin": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "terminado": 1, "terri": [23, 24], "terril": 48, "tessa": [5, 7, 50], "tessa_clust": 3, "tessa_cluster_top10": 3, "tessa_embed": 3, "tessa_fin": 3, "tessa_gex": 3, "tessa_log": 3, "tessa_main": 3, "tessa_ob": 3, "tessa_tcr": 3, "tessa_tcr_embed": 3, "test": [1, 3, 4, 5, 7, 8, 11, 14, 16, 17, 19, 23, 25, 28, 33, 36, 38, 40, 41, 49], "test_haniffa": 3, "test_ligand": 25, "test_overestim_var": 3, "test_sampl": 13, "test_var": 13, "testig": 14, "tether": 24, "tetram": 4, "tetsutaro": 24, "text": [2, 4, 18, 21, 26, 36, 38, 42], "text2vec_0": 8, "text_color": 42, "text_html": 42, "textbf": 38, "textcoord": 7, "texttabl": [1, 7], "tf": [8, 9, 15, 27, 28], "tf_cpp_min_log_level": [5, 27, 28, 36], "tf_name": [8, 26], "tfbstools_1": 8, "tfmpvalue_0": 8, "tfmr_dropout": 3, "tfmr_embedding_s": 3, "tfmr_encoding_lay": 3, "tfmr_num_head": 3, "tfrc": [5, 12, 27, 38], "tfrt_cpu_0": 16, "tfs_path": 26, "tg": [36, 38], "tgacagtcatggctgc": 28, "tgagactcaatagtag": 28, "tgatataaatctttr2": 49, "tgcgaaagcgggcgggctacgattactatgatagtagtgactgacc": 2, "tgcgcagtctcaagtg": 3, "tgcggaacatgggatagcagcctgagtgcttgggtgttc": 2, "tgctcgtgttcgaagg": 23, "tgf": 16, "tggcc": 49, "tggtt": 49, "tggttttaat": 49, "tgtgaaggtcaata": 49, "tgtgcagcatgggatgacagcctgagtgcctcttatgtcttc": 2, "tgtgcgaaagcttggatcggactcgactccgagatttattatgatt": 2, "tgtgcgaaccccacccgtccatatagcagcagctggtggtactttg": 2, "tgtgcgagagacaaccgagtctattacgatttttggagtggttatc": 2, "tgtgcgagagatcgtcgttcagcttattgtagtggtggtagctgct": 2, "tgtttttgtctgca": 49, "tgtttttgtctgcar1": 49, "th": 13, "thakor": [16, 48, 50], "thakurta": 24, "thalamu": 41, "thamar": 14, "than": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 28, 33, 34, 36, 37, 38, 39, 44, 46, 49], "thank": 7, "thankfulli": 21, "thap3": 3, "tharp": 2, "thei": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 44, 48, 49, 50, 51], "theislab": [2, 27, 28, 30, 50], "them": [1, 2, 3, 4, 5, 7, 9, 11, 13, 14, 16, 19, 21, 23, 24, 25, 27, 28, 31, 32, 33, 34, 36, 37, 43, 45, 46, 48, 50, 51], "theme": 8, "theme_class": 8, "theme_cowplot": 8, "theme_grai": 8, "theme_set": 8, "themi": 8, "themselv": [16, 19, 22, 23, 24, 25, 36, 38, 50], "theodor": [5, 7, 17, 24, 26, 50], "theodoro": 7, "theorem": 26, "theoret": [0, 3, 23, 33], "theori": [4, 6, 7, 13, 24, 31, 50], "therapeut": [4, 17, 24], "therapi": [2, 16], "therebi": [2, 3, 4, 5, 15, 24, 50], "therefor": [1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 36, 38, 40, 41, 44, 45, 48], "therein": 51, "theresa": 49, "thermoplast": 2, "theta": 23, "thgen": 15, "thi": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51], "thibeault": [17, 26], "thibodeau": 11, "thicker": 1, "thickest": 1, "thielert": 29, "thieri": 37, "thierri": [1, 30], "thin": [2, 24], "thing": [5, 7, 19, 48], "think": [1, 25, 30], "third": [4, 5, 7, 17, 33, 36, 38], "thirti": [7, 11, 27, 28, 34, 48], "thoma": [1, 3, 5, 7, 13, 14, 15, 16, 17, 19, 22, 23, 26, 37, 47, 49, 50], "thomson": [23, 49], "thorvaldsd": 15, "those": [1, 2, 5, 7, 8, 9, 14, 15, 19, 21, 23, 24, 25, 26, 27, 30, 34, 38, 39, 46, 48, 49], "though": [2, 7, 13, 15, 19, 23, 24, 27, 28, 29, 49, 50, 51], "thought": [5, 11, 25, 30], "thousand": [5, 13, 14, 16, 17, 24, 28], "thp": 16, "thread": [13, 23], "threadpoolctl": [1, 7, 15, 21, 25], "three": [1, 2, 3, 4, 5, 7, 9, 10, 13, 15, 16, 18, 19, 21, 23, 24, 25, 26, 27, 31, 33, 34, 37, 39, 41, 49, 51], "threshold": [1, 3, 4, 5, 13, 19, 23, 25, 26, 34, 36, 37, 46, 48, 49, 50], "through": [1, 2, 3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 18, 19, 21, 23, 24, 25, 26, 29, 30, 31, 34, 36, 37, 39, 40, 41, 45, 48, 49, 50, 51], "throughout": [2, 5, 9, 13, 19, 23, 34, 36, 49], "throughput": [1, 2, 4, 9, 13, 16, 18, 19, 22, 23, 24, 26, 31, 38, 49], "thu": [5, 7, 14, 15, 16, 23, 25, 26, 36, 44, 45, 47, 48, 49, 50, 51], "thuc": 24, "thumb": [11, 13, 26, 49], "thurman": 14, "thymocyt": 5, "thymu": 2, "ti": [23, 50, 51], "tian": [5, 6, 23, 24, 36, 38, 47, 48, 49], "tianqi": 24, "tianxiao": 37, "tianyu": [14, 25], "tianyuan": 25, "tibbl": [7, 21, 25], "tibble_3": [8, 25, 27, 28], "tick": 23, "tick_param": 5, "tickl": 50, "tickotski": 4, "tidi": 7, "tidyr": [7, 21, 25], "tidyr_1": [8, 25, 27, 28], "tidyselect": [7, 21], "tidyselect_1": [8, 25, 27, 28], "tierrafr": 26, "tiesmey": 40, "tieu": 24, "tif": 37, "tiff_0": 8, "tig": 30, "tight": 15, "tight_layout": [4, 11, 13, 26, 38], "tigit": [12, 45], "tild": 36, "tile": 23, "tiledb": 21, "tilgner": 24, "tillag": 1, "tim": [5, 7, 9, 14, 19, 27, 28], "time": [0, 1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 34, 38, 41, 50, 51], "time_after_lp": 2, "time_yr": 19, "timechange_0": 25, "timedate_4022": 25, "timen": 5, "timeout": 25, "timepoint": [13, 36, 51], "timo": [24, 40], "timothi": [24, 50], "timp1": 25, "ting": [5, 25, 49], "tini": 24, "tip": [13, 49], "tirosh": [13, 22, 23, 24, 49], "tissu": [2, 5, 7, 9, 13, 15, 16, 17, 24, 25, 32, 37, 39, 40, 41, 49, 50, 51], "tit": 50, "titl": [3, 11, 13, 14, 16, 17, 22, 36, 49], "tl": [1, 2, 3, 4, 5, 6, 7, 11, 13, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 33, 34, 36, 37, 38, 43, 44, 45, 49, 50, 51], "tle1": 8, "tlz": 1, "tm": 4, "tm9sf2": 8, "tmem140": 25, "tmlhe": 7, "tmm": 13, "tmp": [3, 4, 5, 27, 28], "tmpihngzax_": 5, "tmsb4x": 14, "tn5": 9, "tnf": 12, "tnfrsf13c": 27, "tnfrsf25": 7, "tnfrsf9": 27, "tnfsf10": [15, 25], "tnrc6b": 8, "to_adata": 5, "to_csv": [2, 3, 4, 11, 14, 36], "to_df": [15, 19], "to_list": 1, "to_numpi": [15, 17], "toarrai": [5, 13, 19, 36, 37], "tobia": [14, 17, 23, 24, 26, 50], "tocoo": 33, "tocsc": 33, "todai": [0, 17, 24], "todd": 15, "todens": 3, "todo": [2, 3, 4, 9, 28], "toexclud": 11, "togeth": [1, 5, 6, 7, 8, 9, 11, 13, 16, 18, 23, 24, 27, 28, 34, 37, 38, 48, 49, 50], "toggl": 23, "togkousidi": 23, "toi": 5, "tokcan": 38, "tol": 37, "toler": [23, 37], "tolist": [4, 5, 17, 19, 27, 37, 44, 45, 46], "tolou": 24, "tom": [23, 24, 51], "toma": 23, "tomaso": 50, "tombor": 23, "tomer": [3, 4], "tommaso": [11, 38], "tomohiro": 5, "tong": [7, 11, 13, 25, 27, 28, 34, 36, 48], "toni": [13, 22], "too": [7, 8, 11, 13, 16, 19, 25, 27, 28, 34, 49], "took": [7, 16, 24], "tool": [0, 1, 2, 3, 4, 5, 6, 7, 8, 13, 14, 15, 16, 17, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 36, 40, 50, 51], "toolbox": [14, 16, 37], "toolkit": [1, 2, 4], "tools_4": 8, "toolz": [1, 7], "top": [0, 3, 5, 6, 7, 8, 11, 14, 15, 16, 19, 23, 26, 28, 31, 32, 33, 41, 49], "top10": [25, 41], "top2a": 51, "top_100_gen": 16, "top_10_clon": 3, "top_10_clust": 3, "top_gen": 51, "top_ligand": 25, "top_n": [25, 26], "top_tf": 26, "topic": [4, 5, 8, 9, 22, 23, 26, 30, 36], "topographi": [36, 40], "topolog": 25, "topologi": [6, 25, 49, 50], "toptag": 14, "torbj": 23, "torch": 7, "torchmetr": 7, "torlai": 7, "tormo": [25, 36, 41], "tornado": [1, 7, 15, 21, 25], "torrent": 24, "tosti": 40, "total": [1, 2, 5, 7, 8, 13, 14, 15, 16, 17, 21, 23, 33, 34, 36, 37, 41, 48, 49], "total_count": [11, 19, 21, 27, 28, 31, 33, 34, 37, 41, 43, 44, 45, 46, 47, 48], "total_count_upp": 11, "total_counts_hb": 34, "total_counts_mt": [21, 34, 37], "total_counts_ribo": 34, "total_fragment_count": 11, "touch": [21, 30], "toussaint": 50, "toward": [4, 5, 7, 9, 11, 14, 15, 16, 25, 51], "town": [14, 32], "towoard": 4, "toxic": 16, "toxin": 2, "toy_human_ref": 23, "toy_read_fastq": 23, "tp53": 49, "tpm": 7, "tprocess": 14, "tpu": [5, 7, 16, 27, 28, 36], "tpuplatform": 5, "tqdm": [1, 5, 6, 7, 15, 25, 50], "tqdmwarn": [5, 6, 15, 50], "tr": [4, 14], "tra": [1, 2, 4], "traag": [5, 6, 37, 50], "trac": [2, 27], "trace": 50, "traceback": 23, "tracer": [2, 49], "tracerlib": 1, "traci": [4, 5, 7, 50], "track": [3, 4, 7, 11, 16, 19, 27, 28, 34, 48, 49, 50, 51], "tracker": 30, "trade": [2, 4, 23, 51], "tradit": [23, 32, 49, 51], "tradition": [25, 30, 49, 50, 51], "train": [3, 4, 5, 11, 13, 19, 23, 27, 28, 36, 37, 43], "train_adata": 5, "train_adata_emb": 5, "train_genes_df": 38, "train_loss_epoch": [5, 16], "train_loss_step": [5, 16], "train_scor": 38, "train_siz": 36, "trainedencod": 3, "trainer": [5, 7, 16, 27, 28, 36], "training_gen": 38, "training_genes_df": 38, "training_histori": 38, "traitlet": [1, 7, 15, 21, 25], "traj": 4, "traj10": 4, "traj13": 4, "traj30": [2, 4], "traj31": [2, 4], "trajanoski": [2, 13, 19], "trajectori": [5, 6, 7, 11, 16, 17, 18, 19, 23, 28, 37, 49, 50, 51], "tran": [7, 26], "transact": 50, "transcrib": [9, 18, 23, 24, 51], "transcript": [2, 3, 5, 7, 8, 9, 11, 14, 15, 16, 17, 18, 23, 25, 26, 33, 34, 36, 38, 39, 41, 48, 49, 50, 51], "transcriptas": 18, "transcription": [5, 16], "transcriptom": [2, 4, 5, 7, 16, 17, 18, 19, 22, 25, 26, 28, 30, 31, 36, 37, 38, 39, 41, 44, 45, 47, 48, 49, 50, 51], "transcriptome_fasta": 23, "transdifferenti": 13, "transduct": [25, 48, 49], "transf_cell_typ": 5, "transf_cell_type_certain": 5, "transf_cell_type_unc": 5, "transfer": [1, 5, 7, 9, 10, 11, 16, 21, 27, 36], "transform": [3, 4, 5, 7, 11, 13, 15, 16, 17, 18, 19, 23, 31, 32, 33, 34, 37, 38, 40, 41, 42, 47, 50, 51], "transient": [23, 50, 51], "transit": [1, 5, 7, 12, 13, 15, 17, 18, 26, 29, 30, 42, 49, 50, 51], "translat": [1, 11, 13, 18, 23, 25, 34, 51], "transmit": 9, "transpar": [5, 42], "transplant": [1, 17], "transport": [25, 49], "transpos": [3, 4, 7, 11, 17, 19, 26, 34, 44], "transposas": 9, "transposit": [9, 11], "trap": [13, 24], "trape": 2, "trapnel": [5, 23], "trav": 4, "trav16": 2, "trav19": 1, "trav2": 4, "trav20": 4, "trav21": 4, "trav26": 4, "trav29": 1, "trav3": 4, "trav34": 2, "trav38": 4, "trav5": 4, "trav8": [2, 4], "travaglini": [5, 7, 50], "travi": [7, 24], "travlo": 1, "trb": [1, 2, 4], "trbc1": 2, "trbc2": [2, 5, 12], "trbd2": 1, "trbj": 4, "trbj1": [2, 4], "trbj2": [2, 4], "trbv": 4, "trbv10": [1, 4], "trbv11": 1, "trbv13": 4, "trbv14": 4, "trbv18": [1, 4], "trbv19": [1, 2], "trbv5": [1, 2, 4], "trbv6": 4, "trbv7": [1, 2, 4], "treaci": [7, 11, 27, 28, 34, 48], "treat": [14, 15, 16, 23, 25, 48], "treatment": [3, 13, 14, 15, 16, 22, 25, 48], "treatment_label": 16, "tree": [7, 13, 16, 27, 50], "tree_kei": 13, "trefzer": [24, 40], "treg": [2, 5], "trei": [15, 49], "trem1": 12, "tremend": 9, "trend": [14, 23, 30, 34, 36, 49], "trever": 49, "tri": [2, 7, 11, 16, 24, 51], "trial": [3, 18], "trial_": 3, "trial_0": 3, "trick": 28, "tricki": 13, "trigger": [1, 23, 25, 51], "triglia": 7, "trim": [3, 13, 18, 23], "trimm": 3, "trimmed_2_ful": 4, "trimodal_neurip": 27, "tripl": 49, "triticumaestivum": 4, "tritschler": 51, "trivial": 23, "trm": 5, "trna": 24, "trombetta": [23, 24, 49], "trrust": 26, "true": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 41, 44, 45, 46, 47, 48, 49, 50, 51], "true_divid": 17, "truli": [23, 25], "trust": [5, 38], "trustabl": 1, "truth": [13, 16, 25, 33, 49], "try": [1, 5, 6, 7, 13, 16, 17, 19, 21, 24, 25, 26, 36, 38, 49, 51], "trygv": 24, "ts16": 49, "ts_": 38, "tsagiopoul": 23, "tsai": 51, "tsang": 47, "tsankov": [5, 7, 50], "tse": [5, 48, 50], "tseng": 25, "tsg": 36, "tsne": [3, 26, 31, 50], "tsne1": [14, 15, 16, 25], "tsne2": [14, 15, 16, 25], "tsp": 4, "tss": [19, 26], "tss_cutoff_low": 11, "tss_enrich": [11, 19], "tss_fail": 11, "tss_filter": 11, "tss_pass": 11, "tss_score": 11, "tss_threshold": 11, "tss_upper": 11, "tsss": 26, "tsuji": 25, "tsv": [1, 2, 3, 10, 11, 19, 21, 23], "tt": [11, 14], "ttaat": 49, "ttccacggttgaggac": 27, "ttccctatttgcta": 49, "ttccctatttgctar2": 49, "ttccggtagttgtaag": [27, 28], "ttcgatttcaggacag": [27, 28], "ttcgatttctgaatcg": 23, "ttctcaaagaattccc": 3, "ttctct": 49, "ttctcttaatt": 49, "ttdpsflgry": 4, "ttest_ind": 17, "ttgen": 50, "ttir": 15, "ttll10": 3, "ttner": [5, 7, 13, 28, 50], "ttr": 41, "ttrust": 26, "tttatgctcgccgtga": 49, "tttcacgacaagct": 13, "tttcagtgaggcga": 13, "tttcagtgcgacat": 13, "tttcagtgtgacca": 13, "tttcagtgttctca": 13, "tttgcgcagctcctct": 49, "tttggttcatgtaaga": 49, "tttggttcatgttacg": 28, "tttggttgtcgtacta": 27, "tttggttgtctcacaa": 28, "tttggtttcacctcgt": 27, "tttggtttcccattcg": 28, "tttggtttccgtccta": 28, "tttggtttcgagaacg": 27, "tttggtttcgatacgt": 27, "tttggtttctgagtgt": 49, "tttggtttcttgcgct": 28, "tttgtcacacatccaa": 49, "tttgtcatctgtcaag": 49, "tttgttgagagtctgg": 28, "tttgttgcagacaata": 28, "tttgttgcatgttacg": 28, "tttgttggtagctttg": 27, "tttgttggtagtcact": 28, "tttgttggtccaatca": 27, "tttgttggtgactaaa": 27, "tttgttggtggcttcc": 11, "tttgttggttctttag": 11, "tttgttggttggccga": 11, "tttgttggtttacttg": 11, "tttgttggtttgtgga": 11, "tttgttgtccctctcc": 27, "tttgttgtcgcgctga": 28, "tttgttgtctagagct": 27, "tttgttgtctctgcca": 27, "tubb3": 41, "tucci": 48, "tuck": [5, 36], "tucker": 7, "tuesta": 16, "tuft": 13, "tuft_ix": 13, "tumor": [2, 3, 5, 17, 23, 24], "tumor_allele_t": 49, "tumor_clone_statist": 49, "tumor_nam": 49, "tumor_statist": 49, "tune": [5, 7, 16, 26, 27], "tuong": [1, 2, 5, 50], "tuoqi": 3, "tupl": [11, 15, 51], "turajl": 49, "turei": [15, 26], "turgai": 36, "turn": [2, 5, 13, 16, 21, 23, 43], "turnov": 50, "tushar": [5, 7, 50], "tutori": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 19, 21, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50], "twice": 24, "two": [1, 2, 3, 4, 5, 7, 8, 9, 11, 13, 14, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 31, 34, 36, 37, 38, 40, 41, 45, 46, 47, 48, 49, 50, 51], "twork": 25, "twve19": 6, "txome": 23, "txp_to_gene_map": 23, "txt": [8, 17, 23, 26, 49], "tyk2": 15, "tyler": [7, 24, 49], "type": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 14, 17, 18, 19, 21, 24, 26, 27, 28, 29, 30, 31, 33, 34, 37, 39, 40, 41, 42, 43, 44, 47, 48, 49, 50, 51], "type_of_queri": 27, "typewrit": 49, "typic": [2, 3, 7, 13, 15, 19, 21, 23, 24, 25, 30, 31, 33, 34, 37, 38, 39, 41, 49, 51], "typing_extens": [1, 7, 15, 21, 25], "typist": 5, "tyrobp": [5, 12, 15], "tz": [7, 21], "tzdb_0": [8, 25], "tzlocal": [7, 15, 21, 25], "tzu": 14, "t\u00fcrei": 25, "u": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 15, 16, 19, 23, 24, 27, 28, 34, 36, 37, 38, 39, 40, 41, 45, 48, 51], "u_g": 51, "uba52": 15, "ube2": 26, "ube2l6": 16, "ubingazhibov": 7, "ubiquit": [23, 49], "ubund": 13, "ubuntu": [8, 25], "ucar": 11, "ucsc": [8, 10, 11], "udo": 24, "uduman": 1, "ufunc": [11, 36], "uhl": 37, "uhlen": 24, "uhlitz": 15, "uhrig": [17, 26], "ui": [7, 21], "ui59hvq5": 50, "uint32": 40, "uk": [3, 4, 5, 42], "ukov": 7, "ukw": 2, "ula": [17, 26], "ulrik": 50, "ultim": [5, 9, 23, 25], "ultra": [23, 24, 29, 50], "ultrafast": 23, "um": 39, "umap": [3, 5, 6, 8, 10, 11, 13, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 43, 44, 49, 51], "umap1": 8, "umap2": 8, "umap_0": 8, "umap_1": [10, 21], "umap_mofa": 28, "umap_multivi": 28, "umap_totalvi": 28, "umap_wnn": 28, "umd": 23, "umi": [2, 18, 24, 33, 34, 37, 47, 48, 49], "umic": 23, "umich": 23, "un": [4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 36, 37, 38, 40, 41, 43, 44, 45, 46, 50, 51], "una": 50, "unabl": [5, 21], "unalt": 23, "unambigu": 24, "unavail": [22, 30], "unbias": [11, 13, 17, 24, 36], "unbound": [26, 48], "uncert": 5, "uncertain": [5, 14], "uncertainti": [5, 13, 14, 23, 24, 29, 49, 51], "unchang": 13, "uncharacter": 16, "unclear": [5, 7, 13, 16, 17], "uncom": [4, 11], "uncommon": 7, "uncompress": 23, "unconstrain": 4, "uncorrect": [13, 23], "uncorrel": 31, "uncov": [17, 24, 29, 33, 50], "uncut": 49, "undefin": [13, 17], "under": [1, 2, 3, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 19, 21, 23, 25, 26, 27, 28, 30, 34, 36, 38, 40, 41, 49, 51], "undercount": 23, "underexpress": 14, "undergo": [3, 30], "undergon": 30, "underli": [2, 3, 4, 6, 13, 14, 17, 19, 23, 28, 31, 33, 34, 36, 37, 38, 41, 49, 50, 51], "underlin": 5, "underpin": [21, 30], "underpow": 13, "underrepres": 13, "undersampl": 51, "underscor": [10, 14, 21, 25], "understand": [1, 2, 5, 6, 8, 11, 13, 16, 17, 18, 21, 22, 24, 25, 30, 31, 33, 36, 39, 40, 41, 47, 48, 49, 50, 51], "understood": [19, 38, 50], "undertak": 7, "underutil": 3, "underwood": [23, 24], "undesir": 11, "undirect": [13, 37], "undissoci": 37, "uneven": [9, 18], "unexpect": [5, 11], "unfilt": [15, 34, 47, 48, 49], "unfold": [6, 49], "unfortun": [4, 13, 21, 24], "unicellular": 24, "unifi": [3, 13, 23, 26, 49], "uniform": [1, 13, 23, 31, 33, 38, 49], "uniform_dens": 38, "uniformli": [9, 13, 24], "unimod": [3, 9, 11, 21, 26, 27, 28, 29, 30, 48], "unimport": 0, "uninform": [11, 32, 49], "unintend": 34, "union": 27, "union1d": [25, 49], "uniqfrag": 11, "uniqu": [1, 2, 3, 4, 5, 8, 11, 13, 14, 16, 17, 18, 19, 23, 24, 25, 34, 38, 41, 42, 48, 49], "unit": [1, 2, 7, 9, 14, 15, 18, 24, 30, 41], "univ": 49, "univari": 13, "univers": [9, 23, 31, 49, 50], "unknown": [4, 5, 7, 21, 23], "unlabel": [7, 8], "unlabeled_categori": 7, "unlik": [3, 4, 5, 7, 15, 16, 18, 21, 38, 49], "unlist": 15, "unlock": [23, 51], "unlog": 3, "unment": 24, "unmethyl": 18, "unmix": 17, "unnam": [3, 19], "unnecessari": [4, 21], "unnorm": 19, "unnormalis": 7, "unobserv": [18, 49, 51], "unpair": [16, 29, 38], "unperturb": 16, "unpreced": [15, 25], "unprocess": 51, "unpromis": 23, "unrealist": 11, "unrel": 49, "unsatur": 49, "unscal": 7, "unseen": [5, 16], "unshrunk": 14, "unspecif": 5, "unsplic": [18, 21, 23, 50, 51], "unstabl": 25, "unstimul": 14, "unstructur": 11, "unsuit": 24, "unsupervis": [0, 4, 6], "unsupport": 21, "untarget": [2, 25], "untergass": 13, "until": [1, 2, 3, 4, 6, 7, 34], "untransl": 18, "untreat": [15, 16], "unusu": [5, 23], "unveil": [19, 24, 51], "unwant": [15, 18], "unwritten": 19, "up": [1, 2, 3, 4, 5, 6, 7, 9, 11, 13, 14, 15, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 32, 33, 38, 39, 43, 49, 50], "upadhyai": 2, "updat": [1, 2, 3, 4, 5, 6, 7, 15, 16, 19, 21, 22, 23, 25, 27, 29, 30, 46, 48, 50], "update_obs_column": 27, "upgma": 49, "upgrad": 25, "upload": [5, 50], "upon": [2, 3, 13, 15, 19, 23, 24, 25, 29, 48, 49, 51], "upper": [1, 5, 8, 23, 28, 46, 48, 51], "uppercas": 26, "upregul": 16, "upstream": [1, 23], "upweight": 3, "uri": 1, "uri_templ": 21, "url": [2, 4, 5, 6, 9, 11, 13, 14, 16, 17, 19, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "urllib": 5, "urllib3": [1, 21], "urlretriev": 5, "us": [1, 2, 3, 4, 5, 6, 9, 11, 13, 14, 16, 18, 21, 22, 24, 25, 27, 28, 29, 31, 32, 33, 34, 36, 37, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "usa": 23, "usabl": 5, "usag": [2, 7, 23, 24, 26, 37, 38], "use_batch": 27, "use_batch_norm": 27, "use_gpu": 36, "use_highly_vari": [5, 21, 27, 31], "use_hvg": 26, "use_lay": 27, "use_layer_norm": 27, "use_raw": [15, 25, 41], "use_rep": [5, 7, 13, 16, 19, 26, 27, 28, 31, 36, 38, 44], "user": [0, 4, 6, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 34, 36, 37, 49, 50], "user_guid": [1, 21], "user_instal": [5, 6, 15, 50], "userwarn": [1, 3, 4, 7, 11, 15, 17, 19, 25, 34, 36], "usr": 13, "usual": [2, 3, 5, 6, 7, 9, 13, 14, 16, 17, 18, 19, 21, 23, 24, 28, 31, 32, 34, 36, 37, 38, 39, 41, 43, 46, 48, 49, 50], "utc": [7, 21, 50], "utf": [7, 8, 14, 15, 21, 25, 27, 28], "utf8": [7, 21], "utf8_1": [8, 25, 27, 28], "util": [1, 2, 3, 4, 5, 7, 8, 11, 13, 15, 17, 21, 24, 25, 27, 28, 33, 34, 36, 41, 48, 49], "utils_1": 8, "utils_2": 8, "utils_3": [25, 27, 28], "utils_preprocess": 3, "utils_train": 3, "utr": 18, "uuid_1": 8, "uw": 7, "uwot": [7, 21], "uwot_0": [25, 27, 28], "uytingco": 37, "v": [1, 4, 5, 6, 7, 13, 14, 23, 25, 26, 27, 36, 46, 48, 49, 50, 51], "v0": [1, 2, 3, 4, 21], "v1": [7, 27, 28], "v1_adult_mouse_brain": 37, "v1_adult_mouse_brain_imag": 37, "v2": [23, 25, 37], "v3": [7, 23], "v32": 23, "v4": 27, "v7": 15, "v86": 10, "v9": 26, "v_a_gen": 4, "v_adata": 16, "v_b_gene": 4, "v_call": 1, "v_call_b_vdj": 1, "v_call_b_vj": 1, "v_call_vdj": 1, "v_call_vj": 1, "v_cigar": 1, "v_field": 1, "v_gene": 2, "v_i": 23, "v_j": 23, "v_num": [5, 7, 16, 27, 28, 36], "v_result": 16, "vaccarino": 49, "vaccin": [3, 4], "vaccine": 4, "vae": [16, 27, 28], "vae_loss": 27, "vae_q": 27, "vafadarnejad": [17, 26], "vahid": 24, "vaibhao": 23, "vaidota": 50, "vaishnav": 7, "val": [3, 27, 36, 51], "val_dataload": 36, "val_split": 3, "valdeoliva": 25, "valeh": 7, "valent": [23, 24], "valentin": [7, 24, 41], "valentina": [13, 25], "valeri": [8, 9, 19, 22], "valid": [2, 3, 4, 5, 8, 11, 13, 14, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 49], "validation_step": 36, "valient": 23, "valin": 24, "valiollah": 7, "valkier": 2, "vallei": 48, "vallejo": 14, "valu": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 25, 26, 27, 32, 33, 36, 37, 38, 41, 42, 47, 48, 49, 50], "valuabl": [1, 5, 22, 24, 48, 50], "value_count": [1, 2, 3, 4, 7, 11, 16, 17, 26, 34, 47, 48], "values_to_plot": 43, "vamp3": 3, "vamsi": 15, "van": [5, 6, 7, 13, 14, 16, 23, 25, 26, 31, 36, 49, 50, 51], "vander": 1, "vanderburg": 38, "vanessa": 48, "vanhorn": 49, "vanillagreedi": 49, "vanillagreedysolv": 49, "var": [3, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 43, 44, 45, 46, 47, 48, 49, 50, 51], "var2_": 19, "var2_48": 19, "var2_49": 19, "var2_50": 19, "var_": 19, "var_ad2_": 19, "var_ad2_48": 19, "var_ad2_49": 19, "var_ad2_50": 19, "var_group_label": 16, "var_nam": [5, 10, 11, 13, 14, 17, 19, 21, 25, 26, 27, 28, 32, 34, 36, 37, 38, 41], "var_names_make_uniqu": [11, 19, 34, 37, 41, 43], "var_norm": 41, "varela": 24, "vari": [2, 4, 5, 7, 11, 13, 16, 17, 23, 24, 25, 28, 30, 33, 36, 37, 39, 41, 47], "variability_scor": 28, "variabl": [1, 2, 3, 4, 5, 7, 8, 10, 11, 13, 14, 15, 16, 17, 21, 23, 26, 27, 28, 31, 32, 33, 34, 36, 37, 40, 43, 45, 49, 50, 51], "variablefeatur": [27, 28], "varianc": [6, 7, 13, 14, 15, 17, 21, 31, 32, 33, 37, 38, 41, 50], "variance_ratio": 21, "variances_norm": [15, 37], "variant": [7, 23, 24, 49], "variat": [3, 5, 8, 13, 14, 15, 17, 19, 23, 25, 26, 27, 32, 33, 36, 41, 47, 49, 50, 51], "varieti": [1, 2, 4, 5, 23, 24, 30, 33], "variou": [2, 3, 7, 9, 15, 17, 19, 21, 23, 24, 25, 27, 29, 34, 39, 40, 48, 49], "varm": [5, 7, 13, 14, 15, 19, 21, 27, 28, 36, 37, 43, 45], "varp": [10, 19, 21], "vasilopoul": 29, "vast": [16, 29], "vaz": 15, "vbac016": 15, "vcallcolumn": 1, "vcan": [5, 12], "vcenter": 13, "vctr": [7, 21], "vctrs_0": [8, 25, 27, 28], "vd1": 12, "vdj": [1, 4], "vdj_usag": 1, "vdjdb": 4, "vdjdb_overlap": 4, "vdjpuzzl": 2, "vdjx": 1, "vdvg": 2, "ve": 49, "vector": [3, 5, 6, 11, 14, 16, 17, 19, 23, 24, 31, 32, 34, 36, 38, 49, 50, 51], "veiga": [7, 23, 51], "vel": 26, "velculescu": 49, "velobiri": 51, "veloblp": 51, "velobptd": 51, "velobskt21": 51, "veloc": [18, 21, 22, 23, 50], "velocity_embedding_stream": 51, "velocity_graph": 51, "velocity_umap": 51, "velockh": 51, "velocyto": 21, "velogbw22a": 51, "velogbw22b": 51, "velogwl": 51, "velohz": 51, "velolbk": 51, "velombl": 51, "velomlbd": 51, "velomsz": 51, "veloqh21": 51, "velorod": 51, "velosm": 51, "velozkostlerm": 51, "velozsobrienb": 51, "velten": 28, "veltrop": 36, "vendorlot": [7, 27, 28], "venep": 24, "vento": [25, 36, 41], "ventura": 21, "vera": 13, "verbandt": 2, "verbos": [3, 6, 11, 14, 21, 25, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48], "vere": [17, 24], "veri": [0, 3, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 31, 36, 38, 43, 44, 45, 49], "verif": 26, "verifi": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "vernon": 7, "veronika": [2, 36, 43], "verovskaya": 49, "versa": 23, "versatil": [2, 23], "version": [4, 5, 6, 7, 8, 10, 11, 15, 18, 19, 21, 23, 24, 25, 26, 27, 28, 30, 36, 50], "versu": [1, 5, 6, 8, 9, 11, 14, 15, 21, 23, 24, 32, 49], "vertebr": 50, "vertex": 23, "vertic": [11, 18, 23], "veter": 17, "vh": 4, "vhh": 4, "vhyu": 1, "via": [1, 2, 3, 7, 8, 13, 15, 16, 19, 21, 23, 25, 27, 28, 29, 31, 34, 36, 38, 39, 49], "viabil": 16, "viabl": [1, 34, 48], "vibrat": 2, "vice": 23, "vicin": 25, "vickov": 38, "victor": [14, 17, 24, 26, 49], "victoria": 23, "vidal": 13, "vide": 26, "video": [9, 19, 23], "vidya": 49, "vieira": 23, "vieth": [23, 24], "view": [1, 2, 4, 5, 7, 13, 14, 15, 16, 21, 23, 24, 25, 28, 29, 38, 40, 48, 49], "view_anndata_setup": [7, 36], "viewport": 8, "vignali": 4, "vigneault": 1, "vignett": [16, 19, 21, 27, 28], "vijai": [16, 48, 50], "vijaya": 50, "viktor": [50, 51], "vila": [24, 49], "villani": [7, 11, 24, 27, 28, 34, 48], "vim": 25, "vinai": [7, 8], "vinc": [17, 22], "vincent": [6, 7, 19, 22, 50], "vinh": [17, 26], "vink": 36, "vinyard": 11, "violain": 51, "violat": [23, 34, 51], "violin": [11, 16, 19, 34, 46, 50], "violinplot": 38, "vipor_0": 8, "viral": 1, "virgini": 24, "viridislit": [7, 21], "viridislite_0": [8, 25, 27, 28], "virshup": [19, 21, 37, 40, 41], "viru": [4, 24], "vis_ligand_target": 25, "visan": 17, "vishwaraj": 5, "visibl": [16, 42, 48, 50], "vision": 15, "visit": [9, 11, 25, 31, 41], "visium": [36, 37, 38, 39], "visium_hne_adata": [37, 40, 41], "visnetwork_2": 25, "visual": [0, 1, 3, 4, 5, 6, 7, 9, 10, 11, 13, 19, 23, 26, 27, 28, 30, 31, 34, 36, 37, 40, 43, 44, 45, 46, 51], "visualis": [3, 7, 17, 32], "visvad": 5, "viswanathan": 24, "vita": 4, "vital": 24, "vitalii": [7, 36], "vitessc": 21, "vitro": 49, "vivian": 14, "vivo": [3, 25], "viz": [8, 11], "viztyp": [1, 3], "vj": [1, 2, 4], "vl": 4, "vladimir": [7, 15, 25], "vm21": 49, "vmax": [5, 13, 36], "vmin": [5, 13, 36], "voet": 30, "vogelstein": 49, "volcano": [13, 14], "volcano_plot": 14, "volik": 23, "volk": [17, 26], "volker": [5, 50, 51], "volum": [7, 24, 50], "von": [5, 7, 17, 26, 50], "vorholt": 50, "vote": 5, "vpreb1": [5, 12], "vpv": 49, "vqythfpyt": 4, "vqyvqfpyt": 4, "vrij": 2, "vrooman": 4, "vsmc": 36, "vst": 17, "vukov": 37, "vulner": 24, "vwf": 38, "vyatkin": 16, "w": [1, 4, 5, 7, 9, 14, 15, 16, 19, 23, 24, 26, 30, 34, 36, 41, 49, 50], "w2": 19, "w_": 41, "wa": [1, 2, 3, 4, 5, 6, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "waddington": 49, "wadsworth": [7, 24], "wagar": [3, 4], "wagenstett": 5, "waghrai": 7, "wagner": [3, 5, 6, 7, 16, 17, 23, 36, 49, 50], "wai": [1, 2, 3, 5, 7, 9, 11, 13, 14, 16, 18, 19, 21, 23, 24, 25, 26, 27, 28, 33, 36, 37, 38, 41, 48, 49, 51], "wakimoto": 49, "walczak": 1, "waldman": 7, "waldmann": 24, "waldron": [19, 22], "walk": [9, 50], "walker": [39, 41, 48], "walkthrough": 49, "wall": [14, 15], "walsh": [24, 49], "walter": [5, 23, 24], "waltman": [5, 6, 50], "walzthoeni": [5, 7, 50], "wan": [14, 15, 16, 23, 25, 43], "wang": [2, 3, 4, 5, 7, 9, 11, 14, 15, 16, 23, 24, 25, 26, 27, 28, 31, 34, 37, 38, 39, 41, 48, 49], "want": [1, 2, 3, 4, 5, 6, 7, 10, 11, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 48, 49], "wanwan": 41, "wanz": 50, "waradon": [1, 2], "ward": 4, "ward_o2": 2, "ware": 5, "warm": 23, "warmer": 23, "warn": [1, 2, 3, 4, 7, 8, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 26, 27, 28, 34, 37, 38, 41, 47], "warn_names_dupl": [11, 34], "warnung": [11, 21], "warrant": 23, "wash": 2, "wat18": 2, "watano": 49, "watch": 49, "water": 23, "waterman": 23, "watson": 24, "wavefront": 23, "waveguid": 24, "way": 49, "wcwidth": [1, 7, 15, 21, 25], "we": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "weak": [3, 4, 13, 24], "web": [3, 4, 15, 17], "webapp": 4, "webb": [23, 50], "webcolor": 21, "weber": [2, 6, 23], "webpag": [5, 23], "webshot": [8, 11], "webshot_0": 8, "websit": [23, 37, 49], "websocket": [1, 21], "wedg": 49, "weed": 1, "wei": [4, 7, 14, 15, 16, 24, 37, 40, 44, 49], "weichert": 40, "weight": [1, 3, 5, 7, 8, 13, 25, 26, 27, 36, 37, 38, 41, 42, 51], "weight_decai": [5, 27], "weighted_knn_train": 5, "weighted_knn_transf": 5, "weiler": [50, 51], "weili": 17, "weimin": 37, "weinand": 5, "weinreb": [49, 50], "weiss": [17, 43], "weissman": [38, 49], "weitz": [23, 24], "weixiang": 49, "welch": 51, "well": [1, 2, 3, 4, 5, 6, 7, 11, 12, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 29, 30, 33, 34, 36, 37, 38, 40, 46, 47, 48, 49, 50, 51], "wen": [36, 38, 43, 49], "wencan": 31, "wendi": [7, 13, 22, 48, 50], "wendisch": [17, 26], "weng": 5, "wenhua": 2, "wenji": [24, 39], "wenjuan": 49, "wenjun": [7, 49], "wenqiang": 16, "wensi": 4, "went": 11, "wenwei": 37, "wenyan": 5, "were": [1, 2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 27, 34, 36, 39, 49, 51], "weslei": 25, "wessel": 16, "west": 2, "wet": 24, "wget": [2, 3, 4, 7, 15, 23, 26, 49], "wgw17": 49, "what": [0, 2, 3, 4, 5, 8, 9, 14, 15, 16, 19, 21, 23, 25, 26, 27, 29, 36, 40, 42, 48, 49], "whatev": 7, "wheeler": [23, 24], "when": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 33, 34, 36, 37, 38, 41, 42, 48, 49, 50], "whenev": [14, 21, 51], "where": [1, 2, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 31, 34, 36, 37, 38, 39, 40, 41, 48, 49, 50], "wherea": [1, 2, 5, 8, 15, 16, 17, 19, 24, 34, 40, 41, 49], "wherebi": 15, "wherein": 23, "wherev": 30, "whether": [2, 3, 4, 5, 7, 11, 13, 14, 15, 16, 17, 18, 23, 25, 30, 32, 34, 36, 38, 40, 41], "whh": 49, "which": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 17, 18, 19, 21, 23, 24, 25, 26, 27, 28, 29, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 48, 49, 50, 51], "while": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 27, 28, 30, 31, 33, 36, 38, 39, 43, 48, 49, 50, 51], "whisker": 23, "white": [5, 6, 19, 25, 26, 31, 32, 33, 34, 36, 37, 38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49], "whitegrid": 11, "whitelist": 23, "whitsett": [5, 7, 50], "who": [5, 13, 19, 22], "who_per_sampl": 17, "whole": [2, 7, 19, 21, 23, 24, 38, 39, 48, 49, 51], "whole_blood": 17, "whose": [1, 19, 34, 38], "whp": 6, "why": [3, 4, 7, 8, 10, 16, 18, 24, 30, 34, 38], "wickersham": 24, "wide": [1, 4, 5, 9, 14, 15, 16, 21, 23, 24, 31, 33, 38, 39, 47, 49], "wider": [4, 16, 23], "widespread": [23, 24], "widest": 2, "width": [3, 8, 11, 42], "wien": 5, "wiki": 23, "wilbrei": [5, 7, 50], "wilcoxon": [5, 13, 14, 16], "wild": 38, "wilei": [6, 13, 14, 24], "wilk": [5, 14, 19, 25, 27, 28], "wilko": 40, "willi": 49, "william": [4, 5, 7, 8, 9, 14, 16, 19, 23, 24, 27, 28, 32, 37, 47, 48, 49, 50, 51], "wilson": [2, 4, 23, 24, 48, 50], "wim": 5, "window": [9, 49], "wing": [48, 50], "wire": 24, "wise": [14, 36, 38, 39, 46], "wish": [22, 23, 25], "wit": 49, "with_info": 19, "withdraw": 16, "withdraw_15d_cocain": 16, "withdraw_48h_cocain": 16, "within": [2, 3, 4, 6, 7, 8, 9, 10, 11, 14, 15, 16, 17, 18, 21, 22, 23, 25, 26, 27, 28, 32, 34, 36, 37, 38, 49, 50, 51], "within_sample_network": 3, "without": [0, 1, 2, 3, 4, 5, 7, 14, 15, 21, 23, 24, 26, 31, 34, 37, 41, 49], "withr_2": [8, 25, 27], "witzenrath": [17, 26], "wiv": 4, "wk20": 49, "wk3kbll507v4h18f8nmbzkl80000gq": 49, "wkmacleann19": 25, "wknn": 28, "wnn_connect": [21, 28], "wnn_distanc": 21, "wnn_ref": [27, 28], "wnn_umap": 21, "wnn_umap_": 21, "wnnumap_": [21, 28], "wnnumap_1": 21, "wolabaugh": 2, "wolf": [2, 6, 7, 13, 16, 19, 50, 51], "wolfgang": [14, 19, 22, 23, 24, 33, 51], "wolfram": 25, "wolock": [17, 23], "won": [14, 15, 28], "wonder": 13, "wong": [14, 15, 16, 23, 24, 25, 48], "woo": 3, "woodworth": 49, "word": [15, 23, 25], "work": [1, 2, 3, 4, 5, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 27, 28, 30, 32, 33, 37, 38, 39, 40, 41, 44, 49, 50, 51], "workflow": [1, 2, 3, 4, 7, 11, 13, 15, 18, 19, 21, 22, 23, 24, 30, 32, 41, 43, 50, 51], "workspac": [10, 17, 27, 28], "world": [16, 19, 51], "worlock": [1, 2, 5, 7, 50], "wors": [7, 17], "worsen": 5, "worst": 7, "worst_clinical_statu": 2, "worth": [1, 5, 19, 31, 34, 36, 49], "worthwhil": 7, "would": [0, 1, 5, 6, 7, 11, 13, 14, 15, 16, 19, 23, 25, 26, 27, 28, 33, 34, 36, 38, 45, 47, 48, 49, 50, 51], "wouldn": 7, "wouter": [8, 9, 25, 26, 50], "wozniak": 23, "wp15": 49, "wr16": 6, "wrammert": 2, "wrap": [1, 4, 11, 19, 21], "wrapper": [7, 23], "wrapt": 7, "wrfck20": 49, "write": [1, 2, 3, 5, 8, 11, 15, 17, 23, 31, 32, 33, 34, 38, 44, 45, 46, 47, 48, 49, 50], "write_h5ad": [11, 21], "write_h5mu": 21, "writeh5ad": 21, "writeh5mu": 21, "writer": 21, "written": [0, 7, 19, 23, 25], "wrna": 24, "wrong": [4, 5], "wrongli": [3, 5, 14, 34], "wrote": [21, 50], "wry16": 6, "wshb22": 25, "wsnn": 28, "wspace": [5, 7, 13, 15, 16, 37], "wu": [3, 7, 8, 14, 15, 25, 37, 49, 50], "wume": 49, "wwn": 28, "www": [3, 4, 5, 9, 13, 14, 17, 19, 22, 23, 24, 25, 27, 28, 29, 31, 33, 34, 37, 39, 40, 47, 48, 50], "wyatt": [23, 24], "wyler": [17, 26], "wzc": 25, "w\u00fcnnemann": 36, "x": [2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 41, 44, 45, 46, 47, 48, 49, 50, 51], "x2013": 17, "x27": [11, 13, 16, 19, 28, 44, 45, 46, 47, 48], "x86_64": [1, 7, 8, 15, 21, 25, 27, 28], "x_": 36, "x_adt_elbo": 27, "x_adt_kl": 27, "x_adt_nll": 27, "x_approximate_distribut": 36, "x_arrai": 37, "x_diffmap": 50, "x_glue": 27, "x_harmoni": 36, "x_i": [34, 41], "x_isotyp": [27, 28, 43, 45], "x_lsi": 19, "x_mofa": [21, 28], "x_mofa_umap": 21, "x_multivi": 28, "x_name": 21, "x_pca": [7, 13, 14, 15, 16, 17, 19, 21, 25, 27, 28, 31, 36, 37, 43, 45, 51], "x_pcahm": [27, 28, 43, 44], "x_pert": 16, "x_pixel": 37, "x_rna_elbo": 27, "x_rna_kl": 27, "x_rna_nll": 27, "x_scanvi": 7, "x_scvi": [5, 7, 13], "x_spca": 28, "x_totalvi": [27, 28], "x_totalvi_scarch": 27, "x_tsne": [26, 50], "x_tsne_aucel": 26, "x_umap": [5, 7, 13, 14, 15, 16, 17, 19, 21, 25, 26, 27, 28, 36, 37, 38, 43, 44, 45, 51], "x_umap_aucel": 26, "x_umap_mofa": 28, "x_umap_multivi": 28, "x_umap_totalvi": 28, "x_umap_wnn": 28, "x_wnn_umap": 21, "xavier": [13, 22], "xbp1": [5, 12], "xcell": 17, "xenograft": 49, "xfun_0": [8, 25], "xi": [34, 37, 48], "xiaji": 16, "xian": [24, 36], "xiang": [31, 37, 41], "xiangji": [37, 41], "xiannian": 24, "xiant": 48, "xianwen": 24, "xiao": 37, "xiaofeng": [4, 37], "xiaohui": 49, "xiaoji": [23, 37, 50], "xiaojun": 4, "xiaol": [50, 51], "xiaoman": 25, "xiaomeng": [7, 9], "xiaot": 36, "xiaowei": 38, "xiaowen": 31, "xiaoyang": 25, "xiaoyu": 37, "xie": [9, 48, 49], "xiliang": 24, "ximeng": 49, "xin": [2, 5, 26, 37], "xinfeng": [36, 38], "xing": [7, 31, 37], "xingfan": 23, "xinghua": 38, "xingxu": 39, "xingyi": 7, "xinhai": 49, "xinlei": 3, "xinxin": [9, 15], "xiny": [36, 38], "xinzhu": 9, "xiong": 3, "xirp2": 36, "xiut": 7, "xiuwei": 49, "xiuxiu": 49, "xiuyuan": 13, "xiuzhen": 49, "xla": 5, "xla_extens": 5, "xlabel": [3, 4, 13, 16, 17, 48, 49], "xlim": 26, "xml_3": 8, "xpro": 34, "xtabl": [7, 21], "xtable_1": [8, 25, 27, 28], "xtick_rot": 1, "xticklabel": [4, 25, 26], "xu": [4, 5, 7, 15, 17, 26, 31, 36, 37, 38, 49, 50], "xue": [36, 38], "xuehai": 5, "xuei": 49, "xuesong": 25, "xuetong": [36, 38], "xueyi": [14, 23], "xuhuai": [3, 4], "xun": 37, "xvector": [7, 21], "xvector_0": [8, 15, 27, 28], "xvzf": 49, "xwy": 31, "xy": 37, "xytext": 7, "xzf": 23, "y": [1, 3, 5, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 23, 24, 25, 26, 32, 33, 36, 37, 38, 44, 46, 48, 49, 50, 51], "y2": 19, "y_": [16, 33, 36], "y_0": 33, "y_arrai": 37, "y_pixel": 37, "y_pred": 37, "yaari": 1, "yajima": [14, 34], "yak": 2, "yakubova": 16, "yal": 4, "yaml": [1, 7, 21, 50], "yaml_2": 8, "yamlordereddictload": 1, "yan": [4, 5, 7, 8, 11, 15, 27, 28, 34, 37, 40, 48, 49, 50], "yanai": 17, "yanfang": 38, "yang": [3, 4, 7, 9, 11, 13, 14, 17, 25, 26, 27, 28, 31, 34, 37, 38, 39, 48, 49], "yanmei": 49, "yansheng": 48, "yanxiao": 9, "yanyan": 3, "yanyi": 24, "yanyu": 26, "yao": [3, 24, 25, 36, 38, 49], "yaoxian": 36, "yaqi": 24, "yarden": [13, 22, 51], "yaru": 15, "yasha": 24, "yasmin": 51, "yate": 2, "yde": 50, "ye": [15, 23, 24, 37, 47, 48], "year": [13, 19, 24, 28, 36, 39], "yeast": 25, "yee": 7, "yellow": 23, "yeng": 37, "yeong": 26, "yermano": 2, "yet": [3, 5, 7, 8, 16, 19, 23, 25, 27, 30, 40, 44, 49], "yeung": [5, 14, 16, 19, 27, 28, 48, 50], "yfv": 4, "yi": [16, 17, 49], "yichen": 51, "yield": [3, 19, 23, 25, 31, 49, 51], "yifang": [14, 15], "yii": 25, "yilmaz": [13, 22], "yin": 37, "yine": 7, "ying": [5, 37, 49], "yingxin": 13, "yinlei": [36, 38], "yiqi": 3, "yiwei": 37, "yixuan": 5, "yiyun": 49, "yjn": 49, "ylabel": [4, 13, 16, 48, 49], "ylgnbu": 33, "ylqprtfll": 4, "ymax": 26, "ymin": 26, "ymk": 49, "yml": [1, 2, 3, 4, 5, 6, 7, 8, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "yoav": [14, 51], "yofe": 36, "yohan": 5, "yohei": 24, "yonatan": 28, "yong": [3, 26], "yoon": 49, "yoram": 4, "yosef": [5, 6, 7, 9, 14, 15, 27, 28, 36, 38, 44, 49, 50, 51], "yoseflab": 49, "yoseph": 36, "yoshida": [1, 2, 5, 7, 50], "yoshihiko": [5, 7], "yost": 3, "you": [1, 2, 3, 4, 5, 7, 9, 10, 11, 13, 14, 15, 17, 19, 21, 23, 25, 26, 27, 28, 30, 34, 36, 38, 40, 44, 47, 48, 49, 50], "young": [7, 23, 29, 34, 49], "youp": 49, "your": [1, 2, 3, 4, 5, 6, 8, 9, 10, 11, 13, 14, 15, 16, 17, 19, 21, 23, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "yourself": 5, "youtub": 19, "yscale": 49, "ysebaert": 24, "ysw": 3, "yticklabel": [4, 26], "yu": [7, 15, 25, 26, 43, 49], "yuan": [16, 37, 47, 48], "yuanhua": 51, "yue": [5, 13, 23, 37, 39, 49], "yuejuan": 26, "yuexin": [5, 24], "yuge": [5, 16], "yuhan": [5, 7, 14, 16, 19, 27, 28, 48, 50], "yujia": [15, 37], "yuki": 23, "yukuan": 15, "yulia": 49, "yun": [15, 26, 49], "yung": 15, "yunhe": 26, "yunlong": 15, "yuntian": 37, "yunusov": 23, "yunzhi": 37, "yuqiu": 3, "yuri": 16, "yurii": [7, 44], "yusuk": [34, 48, 49, 50], "yuval": [1, 13, 25], "yuxiang": [37, 39], "yuxuan": 25, "yvan": [25, 50], "yvhu": 1, "yytsnpttf": 4, "z": [5, 6, 7, 8, 13, 15, 16, 17, 19, 23, 24, 36, 37, 38, 40, 48, 50], "z_": 41, "z_corr": 44, "z_i": 41, "z_iz_j": 41, "zach": 8, "zachara": 50, "zachari": [23, 24, 49], "zack": 49, "zadeh": [14, 15], "zagar": [14, 19], "zager": [5, 27, 28], "zaitsev": 17, "zajac": [23, 24, 50], "zakari": 49, "zakeri": [23, 51], "zakharov": 16, "zaleski": 23, "zambelli": 50, "zaneta": 7, "zappia": [5, 7, 21, 23, 28, 30, 34, 50], "zaragosi": [5, 7, 50], "zarnitsyna": 2, "zarr": [1, 18, 19, 21, 50], "zavaleta": 26, "zcw": 3, "zdim": 3, "ze": [2, 3], "zeglinski": 14, "zehua": [50, 51], "zeisel": [23, 24, 50, 51], "zelikovski": 14, "zellkonvert": [11, 21], "zellkonverter_1": 8, "zellkonverter_h5ad_fil": 21, "zemin": 24, "zeng": [5, 24], "zenodo": [2, 11, 25, 49], "zero": [5, 7, 8, 9, 11, 13, 14, 15, 23, 24, 27, 32, 34, 36, 48], "zero_cent": 21, "zeth": 19, "zev": [11, 23], "zewen": [1, 2, 50], "zeyao": 24, "zeynep": [4, 26], "zhang": [2, 3, 4, 5, 7, 9, 11, 13, 15, 16, 17, 22, 23, 24, 25, 26, 27, 28, 34, 36, 37, 38, 41, 44, 48, 49, 51], "zhanlin": 51, "zhao": [7, 13, 15, 25, 36, 37, 38], "zhaohui": 37, "zhaoyang": 25, "zhe": [5, 34], "zhen": [4, 9], "zheng": [5, 14, 16, 19, 23, 24, 25, 27, 28, 37, 47, 48, 51], "zhenmao": 23, "zhi": [7, 27], "zhibao": 5, "zhichao": 7, "zhifeng": 37, "zhijian": 36, "zhou": [5, 9, 15, 41, 49], "zhu": [5, 23, 24, 37, 41, 49], "zhuang": 38, "zichen": 15, "zicheng": 17, "ziegenhain": [23, 24], "ziegler": [7, 36], "zimmerman": 14, "zinb": 7, "zip": [3, 13, 14, 15, 21, 27, 28], "zipp": [1, 7, 15, 21], "zippeliu": 17, "ziqe": 38, "ziqi": 50, "ziraldo": [23, 24], "zixuan": [25, 39, 41], "ziyu": 26, "zizhen": [24, 49], "zjt": 47, "zlatko": [2, 13, 19], "zlh": 25, "zlibbioc": [7, 21], "zlibbioc_1": [8, 15, 27, 28], "zlm": 14, "zlmcond": 14, "zlw": 25, "zmi18": 49, "zmq": [1, 7, 15, 21, 25], "znf215": [5, 12], "znf385d": [5, 12], "znf471": 8, "znrf1": 8, "zo": [27, 28], "zoe": 49, "zone": 36, "zoneinfo": [7, 15, 21, 25], "zong": 23, "zoo": [7, 21], "zoo_1": [25, 27, 28], "zoom": [8, 11, 48], "zorder": 11, "zorzetto": [48, 50], "zou": [25, 36], "zquez": 26, "zscore": 40, "zt21": 30, "zumi": 23, "zvyagin": 4, "zwl": 4, "zxw": 3, "zzt": 25, "\u00df": [17, 26], "\u00e1": [5, 7, 8, 15, 23, 24, 26, 37, 50, 51], "\u00e2": [15, 26], "\u00e4": [14, 15, 17, 23, 24, 26, 50], "\u00e5": 7, "\u00e5sa": 38, "\u00e7": [4, 8, 50, 51], "\u00e8": [19, 22], "\u00e9": [2, 5, 7, 14, 15, 16, 17, 19, 22, 23, 24, 26, 28, 37, 49, 50, 51], "\u00eb": [27, 28], "\u00ed": [26, 49], "\u00ed\u00f1": 23, "\u00f1": [2, 37, 50], "\u00f3": [5, 7, 13, 15], "\u00f6": [7, 14, 15, 17, 23, 24, 26, 50, 51], "\u00f8": 23, "\u00fa": 15, "\u00fc": [5, 7, 11, 13, 15, 17, 23, 24, 25, 26, 27, 28, 31, 34, 48, 50], "\u0107": 50, "\u011f": 4, "\u0131": [4, 5, 23], "\u0144": 7, "\u0148": 7, "\u015b": [19, 22], "\u015f": 4, "\u017e": 5, "\u0263": 2, "\u03b1": [2, 4], "\u03b1\u03b2": 2, "\u03b2": [2, 4, 14, 24, 25], "\u03b21": 16, "\u03b3": 2, "\u03b4": 2, "\u03ba": 2, "\u03bb": 2, "\u2139": 21}, "titles": ["49. Acknowledgements", "39. Clonotype analysis", "38. Immune Receptor Profiling", "44. Integrating AIR and transcriptomics", "43. Specificity analysis", "11. Annotation", "10. Clustering", "12. Data integration", "25. Gene regulatory networks using chromatin accessibility", "23. Single-cell ATAC sequencing", "Conversion of muon objects to Seurat objects to use in downstream analysis", "24. Quality Control", "Markers for cluster annotations across modalities", "17. Compositional analysis", "16. Differential gene expression analysis", "18. Gene set enrichment and pathway analysis", "19. Perturbation modeling", "22. Bulk deconvolution", "50. Glossary", "4. Analysis frameworks and tools", "Data infrastructure", "5. Interoperability", "1. Prior art", "3. Raw data processing", "2. Single-cell RNA sequencing", "21. Cell-cell communication", "20. Gene regulatory networks", "46. Advanced integration", "45. Paired integration", "48. Outlook", "Single-cell best practices", "9. Dimensionality Reduction", "8. Feature selection", "7. Normalization", "6. Quality Control", "47. Reproducibility", "30. Spatial deconvolution", "28. Spatial domains", "31. Imputation", "26. Single-cell data resolved in space", "27. Neighborhood analysis", "29. Spatially variable genes", "<no title>", "37. Annotation", "36. Batch correction", "35. Dimensionality Reduction", "34. Doublet detection", "33. Normalization", "32. Quality control", "15. Lineage tracing", "13. Pseudotemporal ordering", "14. RNA velocity"], "titleterms": {"": [25, 27, 41], "1": 25, "19": 17, "2": 25, "3": 25, "3726_nt_t1": 49, "4": 25, "5": 25, "A": [7, 15, 23, 24, 36], "In": 21, "On": 15, "One": 14, "The": [23, 24, 51], "Will": 13, "With": 13, "about": 13, "abund": [1, 13], "access": [8, 19, 21], "acknowledg": 0, "across": [12, 40], "activ": [15, 25], "ad": 19, "adapt": 2, "adt": [12, 27], "adult": 50, "advanc": [19, 27], "affect": [16, 25], "against": 23, "air": [2, 3], "alevin": 23, "algorithm": 49, "align": [2, 19, 23], "altern": 30, "ambient": 34, "an": [7, 19, 23, 27], "analys": 16, "analysi": [1, 2, 3, 4, 9, 10, 13, 14, 15, 16, 19, 22, 26, 28, 36, 40, 49], "analyt": 33, "anndata": [19, 21], "annot": [5, 12, 43], "api": 19, "appl": 23, "approach": [17, 25], "art": 22, "assai": [9, 10], "assign": 2, "assumpt": 25, "atac": [8, 9, 12], "atla": [27, 29], "attribut": 19, "aucel": 15, "augment": 23, "augur": 16, "author": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 25, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "autoencod": [7, 16], "autom": [5, 43], "awar": 7, "background": 17, "barcod": 23, "base": [5, 7, 11, 21, 23, 24, 36], "batch": [7, 13, 44], "bcr": [1, 3, 4], "benchmark": [7, 29], "beniss": 3, "best": [22, 30], "between": [13, 15, 21, 38, 40], "bioconductor": [21, 22], "biolog": 13, "block": 24, "blood": 17, "bone": [6, 50], "book": [22, 30], "bound": 11, "bridg": 27, "brief": [23, 24], "build": [7, 23, 24, 27, 29], "bulk": [15, 17], "c1": 24, "calcul": [7, 11, 16, 49], "can": 25, "cancer": 49, "case": [15, 25], "cassiopeia": 49, "ccc": 25, "cd4": 16, "cd4t": 16, "cell": [2, 6, 7, 9, 11, 13, 14, 15, 16, 17, 19, 22, 23, 24, 25, 29, 30, 34, 36, 38, 39, 46], "cell2loc": 36, "cellrang": 48, "cellular": 39, "center": 47, "characterist": 9, "choos": 7, "chromatin": [8, 10], "cistop": 8, "citat": 30, "cite": 28, "classifi": 5, "clonal": 1, "clonotyp": 1, "cluster": [3, 5, 6, 12, 13, 15], "co": 40, "collect": [15, 48], "combin": 25, "common": [19, 38], "commun": [25, 40], "comparison": [1, 7, 15], "complet": [23, 48], "complex": [7, 15], "composit": 13, "comput": [38, 49], "conclus": 49, "condit": [3, 13], "configur": 27, "conga": 3, "consensu": 25, "consid": 25, "consider": 15, "consortia": 19, "construct": [16, 27, 38, 50], "contact": 30, "contribut": [25, 30], "contributor": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "control": [2, 11, 15, 23, 31, 34, 48], "convers": [10, 19], "convert": [8, 10], "copi": 19, "correct": [7, 13, 23, 34, 44], "count": [11, 13, 23], "cours": 49, "cover": 30, "coverag": 11, "covid": 17, "creat": 15, "crispr": 16, "current": 22, "curs": 31, "d": 2, "dandelion": 1, "data": [1, 2, 3, 5, 7, 9, 10, 13, 15, 16, 17, 19, 20, 21, 23, 26, 27, 28, 34, 36, 37, 38, 39, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "databas": 4, "datafram": 19, "dataset": [2, 7, 11, 14, 16, 26, 38], "deconvolut": [17, 36], "deconvolv": 17, "decoupl": 15, "defin": [13, 25], "definit": [1, 9], "demo": 19, "descript": [26, 36], "design": [15, 19], "detect": [11, 16, 23, 34, 37, 46], "determin": 16, "develop": 49, "devic": [23, 24], "differ": [13, 23], "differenti": [5, 13, 14, 16, 25], "dimens": 40, "dimension": [31, 45], "direct": [17, 49, 51], "discret": 36, "discrimin": 16, "discuss": 23, "disk": 21, "distanc": 4, "distribut": [11, 33], "divers": 1, "doe": 30, "domain": 37, "doublet": [11, 23, 34, 46], "down": 50, "download": 49, "downstream": [10, 36], "droplet": 23, "dsb": 47, "dynam": 49, "each": 49, "earli": 7, "ecosystem": 21, "edger": 14, "effect": [13, 15], "effici": 19, "em": 51, "embed": [7, 27], "empti": 23, "end": 29, "endocrinogenesi": 51, "enrich": [11, 15], "environ": [5, 10, 14, 17, 25, 26, 27, 28, 34, 37, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "epitop": 4, "error": 23, "estim": 25, "evalu": [16, 28], "event": 49, "everi": 36, "evolv": 49, "examin": 49, "exampl": [19, 23], "execut": [3, 8], "expans": [1, 49], "experiment": [9, 15], "explor": [15, 16, 25], "express": [5, 14, 15, 36, 37, 38], "extract": 7, "factor": 28, "featur": [7, 8, 9, 11, 32], "figr": 8, "file": 21, "filter": [2, 11, 15, 34, 49], "first": 24, "fit": 36, "fluidigm": 24, "format": [2, 21, 30], "fragment": 11, "framework": 19, "from": [5, 21, 26, 38, 49], "fry": [15, 23], "full": [7, 23], "further": 36, "gamma": 33, "gather": 26, "gene": [1, 5, 7, 8, 14, 15, 16, 25, 26, 36, 37, 38, 41], "gener": [5, 24, 25, 26, 51], "genom": 23, "gex": 3, "glossari": 18, "glue": 27, "graph": [7, 27, 37], "grn": 26, "ground": 7, "group": 14, "gsea": 15, "h5ad": [8, 21], "ham": 4, "harmon": 7, "harmoni": 44, "hdf5": 21, "hierarch": 13, "histologi": 37, "histori": 24, "how": 7, "html": 8, "human": [6, 15, 50], "hyperparamet": 37, "hypothes": 15, "i": [7, 13, 41], "ident": 4, "identifi": [16, 40], "ifn": 16, "immun": 2, "import": 16, "imput": [27, 38], "index": 23, "infer": [8, 15, 25, 28, 49, 50, 51], "info": [15, 25, 27], "inform": [7, 21], "infrastructur": 20, "initi": 19, "inspect": 31, "instal": [8, 19], "intbc": 49, "integr": [3, 7, 27, 28, 37], "interact": [25, 40], "intercellular": 25, "interest": 25, "interoper": [1, 21], "interpret": [26, 49], "introduct": [4, 30], "ir": 2, "isol": 2, "j": 2, "javascript": 21, "julia": 21, "kang": 16, "kei": [25, 49], "knowledg": 25, "label": [7, 13], "languag": 21, "larg": 19, "layer": 19, "length": [7, 24], "level": [15, 19, 38], "liana": 25, "licens": 30, "life": 24, "ligand": 25, "limit": [16, 17, 25, 26], "limma": 15, "lineag": 49, "linear": [7, 16], "link": [23, 27], "load": [2, 5, 8, 10, 13, 17, 25, 44, 45, 46, 47, 48, 50, 51], "local": 16, "log": 47, "logarithm": 33, "loom": 21, "low": [15, 34, 49], "lower": 11, "lung": 49, "mani": 7, "manual": [4, 5, 43], "map": [5, 19, 23, 27, 29, 36, 38], "marker": [5, 12, 46], "marrow": [6, 50], "match": 4, "mathemat": 36, "matric": 19, "matrix": 23, "measur": [4, 39], "memori": 21, "metadata": 19, "method": [7, 19, 49], "metric": [4, 11, 28, 31], "microfluid": 24, "mnn": 7, "modal": [3, 12, 29], "model": [3, 7, 16, 25, 36, 49, 51], "mofa": 28, "moran": 41, "more": 36, "most": 16, "motif": 1, "motiv": [3, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 21, 23, 25, 26, 27, 28, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "mous": 49, "mudata": [10, 19, 48], "multi": [28, 39], "multigr": 27, "multimod": [3, 19, 21], "multiom": 28, "multipl": 14, "multivi": 28, "muon": [10, 19], "music": 17, "mutual": 7, "mvtcr": 3, "nanopor": 24, "nearest": [7, 28], "need": 23, "neighbor": [7, 28], "neighborhood": 40, "neighbourhood": 13, "network": [8, 26], "neurip": 26, "new": [17, 21, 49, 51], "ng": 24, "nichenet": 25, "nomenclatur": 21, "normal": [15, 33, 47], "note": [7, 14, 15, 23, 24], "nuclei": 24, "nucleosom": 11, "null": 15, "number": [11, 15, 49], "object": [10, 19, 48], "observ": 19, "occurr": 40, "omic": 28, "onto": 27, "order": 50, "orient": 23, "osca": 22, "osta": 22, "other": 21, "out": [15, 49], "outcom": 26, "outlook": [25, 29, 50], "output": [3, 17, 25, 48], "overdispers": 33, "overlap": 27, "overview": [9, 19, 24, 39, 49], "own": 7, "packag": 8, "pair": 28, "pancreat": 51, "paramet": 51, "part": 38, "partial": [19, 27], "pathwai": 15, "pbmc": 15, "pca": [31, 45], "pearson": 33, "peer": 30, "per": 49, "perform": [11, 15], "perturb": 16, "phylogenet": 49, "pipelin": [23, 29, 49], "plastic": 49, "plate": 24, "plot": 38, "png": 8, "poisson": 33, "pool": 16, "potenti": 25, "practic": [22, 30, 36], "practis": 38, "pre": 36, "preced": 23, "predict": [4, 16, 25, 29], "prepar": [1, 3, 4, 7, 8, 14, 15, 23, 26, 27, 28, 49], "preprocess": [3, 16, 17, 37, 51], "prerank": 15, "prerequisit": 30, "prior": [22, 25], "priorit": 16, "process": [23, 24, 36], "product": 2, "profil": [2, 39], "properti": 49, "proteom": 29, "protocol": 24, "pseudo": 15, "pseudobulk": 14, "pseudotempor": 50, "pseudotim": 50, "public": 26, "python": [7, 21], "qc": [11, 48], "qualiti": [2, 11, 23, 31, 34, 48, 49], "quantif": [23, 24], "quantifi": 49, "queri": [4, 27], "quiz": [2, 3, 4, 7, 8, 13, 14, 15, 16, 25, 26], "r": [7, 17, 21], "ratio": 47, "raw": [2, 23], "rd": 21, "read": [10, 19, 21, 30, 39], "real": 23, "receiv": 25, "receptor": [2, 25], "recombin": 2, "recommend": 39, "reconstruct": 49, "reduct": [31, 45], "redund": 15, "refer": [1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 17, 19, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50, 51], "refin": 37, "region": 36, "regulatori": [8, 25, 26], "regulon": 26, "remark": 5, "remov": [7, 13], "repertoir": [1, 2], "represent": 23, "reproduc": 35, "residu": 33, "resolut": [23, 39], "resolv": 39, "resourc": 49, "respons": 16, "result": [8, 26], "retriev": 15, "review": [5, 6, 7, 8, 9, 11, 13, 14, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 49, 50], "rna": [3, 8, 12, 22, 24, 26, 27, 34, 51], "role": 2, "run": [3, 13, 15, 17], "rust": 21, "sampl": [15, 17, 48], "save": 8, "scalabl": 7, "scanpi": 19, "scenic": 26, "scgen": 16, "scib": 28, "score": [11, 15, 41], "screen": 16, "second": 24, "segment": 1, "select": [7, 32, 49], "sender": 25, "seq": [22, 28], "sequenc": [1, 2, 9, 23, 24], "session": [7, 15, 21, 25, 27], "set": [5, 15, 16, 25, 38, 51], "setup": [5, 10, 14, 15, 17, 25, 26, 27, 28, 34, 37, 40, 41, 44, 45, 46, 47, 48, 49, 50, 51], "seurat": [10, 21, 27], "shift": 33, "should": 30, "signal": [11, 25], "signatur": 16, "silicon": 23, "simpl": 21, "simplifi": 23, "singl": [9, 14, 15, 16, 17, 19, 22, 24, 29, 30, 36, 38, 39], "singlecellexperi": 8, "size": 49, "sne": 31, "sourc": 25, "space": [38, 39], "spagcn": 37, "sparsiti": 9, "spatal": 36, "spatial": [36, 37, 38, 39, 40, 41], "spatiald": 41, "specif": [4, 14, 36], "spectratyp": 1, "splice": 23, "squidpi": [37, 41], "state": [2, 51], "statist": 49, "steadi": 51, "step": [23, 25], "stereoscop": 36, "stimul": [15, 16], "stop": 7, "store": 19, "stream": 50, "strict": 4, "structur": [13, 30], "studi": [15, 25], "sub": 39, "subset": 19, "summari": [24, 25], "system": 2, "t": [16, 31], "takeawai": [25, 49], "tangram": 38, "target": 25, "task": 50, "tcr": [1, 3, 4], "tcrdist": 4, "tcrmatch": 4, "technic": 15, "technologi": [38, 49], "tessa": 3, "test": [13, 15], "tf": 26, "theori": [8, 26], "thi": 30, "third": 24, "threshold": 11, "time": 49, "tissu": 36, "tool": [19, 49], "top": 25, "total": [11, 28], "totalvi": [27, 28], "trace": 49, "train": [7, 16, 38], "transcript": 24, "transcriptom": [3, 23, 24], "trap": 17, "tree": 49, "trimod": 27, "truth": 7, "tss": 11, "tumor": 49, "tutori": 22, "two": 15, "type": [7, 13, 15, 16, 23, 25, 36, 38, 46], "u": 30, "umap": [7, 31, 45], "umi": [7, 23], "uni": 3, "unifi": 27, "unimod": 19, "unintegr": 7, "unpair": 27, "unstructur": 19, "up": 16, "upper": 11, "us": [7, 8, 10, 15, 17, 19, 23, 26, 38], "usag": 1, "v": [2, 15, 24], "vae": 7, "valid": [17, 38], "variabl": [19, 41], "variat": [7, 16, 28], "variou": 4, "vdj": 2, "veloc": 51, "via": 4, "view": 19, "visual": [2, 8, 14, 16, 17, 25, 49], "voxel": 38, "warn": 5, "weight": 28, "were": 38, "what": [7, 13, 30], "who": 30, "whole": 17, "why": 13, "wider": 5, "wise": 48, "without": 13, "wnn": [27, 28], "workflow": 9, "world": 23, "write": [19, 21], "your": 7, "zellkonvert": 8, "\u03b2": 16}}) \ No newline at end of file diff --git a/pr-preview/pr-344/trajectories/pseudotemporal.html b/pr-preview/pr-344/trajectories/pseudotemporal.html index cc3155b6..8c75f79e 100644 --- a/pr-preview/pr-344/trajectories/pseudotemporal.html +++ b/pr-preview/pr-344/trajectories/pseudotemporal.html @@ -601,7 +601,7 @@
This book uses lamindb to store, share, and load datasets and notebooks using the theislab/sc-best-practices instance. We acknowledge free hosting from Lamin Labs.
import lamindb as ln
-af = ln.Artifact.get(key="key_of_dataset", is_latest=True)
+af = ln.Artifact.get(key="key_of_dataset", is_latest=True) # or ln.Artifact("SOMEID").get()
obj = af.load()
The object is now accessible in memory and is ready for analysis.
+The object is now accessible in memory and is ready for analysis.
+Adapt the ln.Artifact("SOMEID").get()
suffix to get older versions like ln.Artifact("SOMEID0001").get()
to get the second uploaded version.
Accessing notebooks (Transforms)
lamin load <notebook url>
which will download the notebook to the current working directory.
+which will download the notebook to the current working directory.
+Analogously to Artifacts
, you can adapt the suffix ID to get older versions.
**On ln.track()
and ln.finish()
On ln.track()
and ln.finish()
These functions are currently only available for users with write access and may error. Please comment them out for now.