diff --git a/ABTS_ox.dwxmz b/ABTS_ox.dwxmz index a868263..da7766b 100644 Binary files a/ABTS_ox.dwxmz and b/ABTS_ox.dwxmz differ diff --git a/ontologies/KG-DWSIM_EnzML_ELN.owl b/ontologies/KG-DWSIM_EnzML_ELN.owl index 86209df..44363b9 100644 --- a/ontologies/KG-DWSIM_EnzML_ELN.owl +++ b/ontologies/KG-DWSIM_EnzML_ELN.owl @@ -6,8 +6,8 @@ xml:base="https://w3id.org/nfdi4cat" xmlns="https://w3id.org/nfdi4cat#" xmlns:core="http://www.w3.org/2004/02/skos/core#" - xmlns:obo="http://purl.obolibrary.org/obo/" xmlns:cheb="http://purl.obolibrary.org/obo/chebi/" + xmlns:obo="http://purl.obolibrary.org/obo/" xmlns:meta="http://w3id.org/nfdi4ing/metadata4ing#"> @@ -258,200 +258,200 @@ isImportedAs - - isSalt - - - - hasSourceOrganism - - has_role - - isBlackOil + + hasCriticalVolume hasCriticalPressure - - hasChao_SeaderSolubilityParameter - - - - hasRackettCompressibility - - - - has_nbps + + isIon - - hasEC_Number + + hasIdealGasEnthalpyOfFormation_25Celsius hasTempOptimum - - hasEnzymeML_ID - - - - hasChao_SeaderSolubilityParameter_Unit + + isCoolPropSupported - - hasCriticalVolume_Unit + + hasSourceOrganism - - hasStoichiometricCoefficient + + has_organism hasCriticalTemperature - - isSolid + + has_pH_Optimum - - hasIdealGasGibbsEnergyOfFormation_25Celsius_Unit + + isSolid - - hasDirect_OrderCoefficient + + has_nbps - - has_function + + hascriticalCompressibility - - hasCriticalVolume + + hasIdealGasEnthalpyOfFormation_25Celsius_Unit - - hasChao_SeaderLiquidMolarVolume + + has_ecnumber - - isIon + + isBlackOil - - hasIdealGasEnthalpyOfFormation_25Celsius_Unit + + hasCriticalVolume_Unit - - hasChao_SeaderAcentricFactor + + hasAcentricFactor hasSMILES - - hasReverse_OrderCoefficient + + isModified - - isHydratedSalt + + hasTemperature_Unit - - hasAcentricFactor + + hasDirect_OrderCoefficient - - hascriticalCompressibility + + hasCriticalPressure_Unit - - isCoolPropSupported + + has_sequence - - has_organism + + hasCAS_Number - - hasIdealGasGibbsEnergyOfFormation_25Celsius + + hasReverse_OrderCoefficient + + + + hasChao_SeaderAcentricFactor + + + + isHydratedSalt + + + + hasMolecularWeight_Unit + + + + hasEC_Number has_nbps_Unit - - hasTemperature_Unit + + hasMolecularWeight hasFormula - - hasCAS_Number - - - - isF_PropsSupported + + inDWSIMdatabase - - hasDWSIM_ID + + hasChao_SeaderSolubilityParameter_Unit hasRelativeDensities - - has_pH_Optimum + + has_function - - has_ecnumber + + hasIdealGasGibbsEnergyOfFormation_25Celsius_Unit - - hasMolecularWeight + + hasChao_SeaderSolubilityParameter - - has_sequence + + hasStoichiometricCoefficient + + + + isF_PropsSupported + + + + hasIdealGasGibbsEnergyOfFormation_25Celsius kineticDescription - - hasMolecularWeight_Unit + + hasEnzymeML_ID - - hasCriticalPressure_Unit + + hasRackettCompressibility - - inDWSIMdatabase + + hasChao_SeaderLiquidMolarVolume - - isModified + + hasDWSIM_ID - - hasIdealGasEnthalpyOfFormation_25Celsius + + isSalt @@ -1471,10 +1471,12 @@ process depending on the context in which it occurs. For example, the observed e unit operation heating - - - Laccase - Laccase + + + Oxygen + oxygen + O=O + InChI=1S/O2/c1-2 @@ -1484,6 +1486,12 @@ process depending on the context in which it occurs. For example, the observed e CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC + + + Laccase + Laccase + + ABTS_ox @@ -1491,14 +1499,6 @@ process depending on the context in which it occurs. For example, the observed e CCN1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC - - - Oxygen - oxygen - O=O - InChI=1S/O2/c1-2 - - Water @@ -1543,31 +1543,39 @@ process depending on the context in which it occurs. For example, the observed e chemical material storage - - - - - Sub_Laccase_p2 - Laccase - Trametes versicolor - MGLQRFSFFVTLALVARSLAAIGPVASFVVANAPVSPDGFLRDAIVVNGVVPSPLIRAKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATVINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWVRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTPSVIPLIETNLHPLARMPVPGTRTPGGVDKALKLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQELLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNLGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEADQ - 1.10.3.2 - p2 - 0 + + + + + Sub_Oxygen_s1 + oxygen + s1 + -1 0 0 + True + + + + + + + Sub_ABTS_red_s0 + ABTS reduced + s0 + -4 + 1 + 0 False - oxidoreductase activity - r0 None 375.15 K - 56000 + 514.619 kg/kmol - -6497 - 80498-15-3 - CC[C@H](C)[C@@H](C(N1CCC[C@H]1C(=O)O)=O)N=C([C@H](CCC(=N)O)N=C([C@H](CCC(=O)O)N=C([C@H](C)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](C(C)C)N=C([C@H](C)N)O)O)O)O)O)O)O) - C66H109N19O25 + -9626 + 28752-68-3 + CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC + C18H17N4O6S4 647.14 22064000 0.05595 @@ -1587,10 +1595,10 @@ process depending on the context in which it occurs. For example, the observed e False False False - Trametes versicolor - 1.10.3.2 - 4.5-5.0 with ABTS as substrate - 35-55 °C with ABTS as substrate + None + None + None + None K Pa m3/kmol @@ -1599,26 +1607,31 @@ process depending on the context in which it occurs. For example, the observed e mL/mol - - - - - Sub_ABTS_red_s0 - ABTS reduced - s0 - -4 - 1 + + + + + Sub_Laccase_p2 + Laccase + Trametes versicolor + MGLQRFSFFVTLALVARSLAAIGPVASFVVANAPVSPDGFLRDAIVVNGVVPSPLIRAKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATVINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWVRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTPSVIPLIETNLHPLARMPVPGTRTPGGVDKALKLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQELLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNLGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEADQ + 1.10.3.2 + p2 + 0 + 0 0 False + oxidoreductase activity + r0 None 375.15 K - 514.619 + 56000 kg/kmol - -9626 - 28752-68-3 - CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC - C18H17N4O6S4 + -6497 + 80498-15-3 + CC[C@H](C)[C@@H](C(N1CCC[C@H]1C(=O)O)=O)N=C([C@H](CCC(=N)O)N=C([C@H](CCC(=O)O)N=C([C@H](C)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](C(C)C)N=C([C@H](C)N)O)O)O)O)O)O)O) + C66H109N19O25 647.14 22064000 0.05595 @@ -1638,10 +1651,10 @@ process depending on the context in which it occurs. For example, the observed e False False False - None - None - None - None + Trametes versicolor + 1.10.3.2 + 4.5-5.0 with ABTS as substrate + 35-55 °C with ABTS as substrate K Pa m3/kmol @@ -1653,7 +1666,7 @@ process depending on the context in which it occurs. For example, the observed e - + Sub_ABTS_ox_s2 ABTS oxidized s2 @@ -1701,23 +1714,10 @@ process depending on the context in which it occurs. For example, the observed e mL/mol - - - - - Sub_Oxygen_s1 - oxygen - s1 - -1 - 0 - 0 - True - - - + Sub_Water_ 2 0 @@ -1725,7 +1725,7 @@ process depending on the context in which it occurs. For example, the observed e True - + Experiment_Laccase - Helically Coiled Reactor (HCR) and Straight Capillary Reactor (SCR) Creator(s): @@ -1733,19 +1733,19 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer - - - - + + + + - + @@ -1769,50 +1769,50 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer 1/s - + - - - - - + + + + + indv_Reactant_1 8.33333333333333e-08 m3/s - + - - - + + + indv_Reactant_2 5e-08 m3/s - + - - + + indv_Mixer None None - + - - + + indv_Mixture None None - + - - + + indv_Reactor None None @@ -1831,24 +1831,24 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer 1 - + - + indv_Product_1 None None - + - - + + indv_Heat None None - + Reactant_1_Laccase @@ -1862,7 +1862,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer C - + Reactant_1_ABTS_red @@ -1876,7 +1876,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer C - + Reactant_1_Water @@ -1889,7 +1889,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer C - + Reactant_2_Oxygen @@ -1903,14 +1903,14 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer C - + - + - + ABTS oxidation, HTR_r0 311.15 K @@ -1919,9 +1919,9 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer r0 - + - + @@ -1934,9 +1934,9 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer r1 - + - + diff --git a/ontologies/KG-DWSIM_EnzML_ELN_output.owl b/ontologies/KG-DWSIM_EnzML_ELN_output.owl index 806e84d..3016ead 100644 --- a/ontologies/KG-DWSIM_EnzML_ELN_output.owl +++ b/ontologies/KG-DWSIM_EnzML_ELN_output.owl @@ -259,200 +259,200 @@ isImportedAs - - isSalt - - - - hasSourceOrganism - - has_role - - isBlackOil + + hasCriticalVolume hasCriticalPressure - - hasChao_SeaderSolubilityParameter - - - - hasRackettCompressibility - - - - has_nbps + + isIon - - hasEC_Number + + hasIdealGasEnthalpyOfFormation_25Celsius hasTempOptimum - - hasEnzymeML_ID - - - - hasChao_SeaderSolubilityParameter_Unit + + isCoolPropSupported - - hasCriticalVolume_Unit + + hasSourceOrganism - - hasStoichiometricCoefficient + + has_organism hasCriticalTemperature - - isSolid + + has_pH_Optimum - - hasIdealGasGibbsEnergyOfFormation_25Celsius_Unit + + isSolid - - hasDirect_OrderCoefficient + + has_nbps - - has_function + + hascriticalCompressibility - - hasCriticalVolume + + hasIdealGasEnthalpyOfFormation_25Celsius_Unit - - hasChao_SeaderLiquidMolarVolume + + has_ecnumber - - isIon + + isBlackOil - - hasIdealGasEnthalpyOfFormation_25Celsius_Unit + + hasCriticalVolume_Unit - - hasChao_SeaderAcentricFactor + + hasAcentricFactor hasSMILES - - hasReverse_OrderCoefficient + + isModified - - isHydratedSalt + + hasTemperature_Unit - - hasAcentricFactor + + hasDirect_OrderCoefficient - - hascriticalCompressibility + + hasCriticalPressure_Unit - - isCoolPropSupported + + has_sequence - - has_organism + + hasCAS_Number - - hasIdealGasGibbsEnergyOfFormation_25Celsius + + hasReverse_OrderCoefficient + + + + hasChao_SeaderAcentricFactor + + + + isHydratedSalt + + + + hasMolecularWeight_Unit + + + + hasEC_Number has_nbps_Unit - - hasTemperature_Unit + + hasMolecularWeight hasFormula - - hasCAS_Number - - - - isF_PropsSupported + + inDWSIMdatabase - - hasDWSIM_ID + + hasChao_SeaderSolubilityParameter_Unit hasRelativeDensities - - has_pH_Optimum + + has_function - - has_ecnumber + + hasIdealGasGibbsEnergyOfFormation_25Celsius_Unit - - hasMolecularWeight + + hasChao_SeaderSolubilityParameter - - has_sequence + + hasStoichiometricCoefficient + + + + isF_PropsSupported + + + + hasIdealGasGibbsEnergyOfFormation_25Celsius kineticDescription - - hasMolecularWeight_Unit + + hasEnzymeML_ID - - hasCriticalPressure_Unit + + hasRackettCompressibility - - inDWSIMdatabase + + hasChao_SeaderLiquidMolarVolume - - isModified + + hasDWSIM_ID - - hasIdealGasEnthalpyOfFormation_25Celsius + + isSalt @@ -1488,10 +1488,12 @@ process depending on the context in which it occurs. For example, the observed e unit operation heating - - - Laccase - Laccase + + + Oxygen + oxygen + O=O + InChI=1S/O2/c1-2 @@ -1501,6 +1503,12 @@ process depending on the context in which it occurs. For example, the observed e CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC + + + Laccase + Laccase + + ABTS_ox @@ -1508,14 +1516,6 @@ process depending on the context in which it occurs. For example, the observed e CCN1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC - - - Oxygen - oxygen - O=O - InChI=1S/O2/c1-2 - - Water @@ -1560,31 +1560,51 @@ process depending on the context in which it occurs. For example, the observed e chemical material storage - - - - - Sub_Laccase_p2 - Laccase - Trametes versicolor - MGLQRFSFFVTLALVARSLAAIGPVASFVVANAPVSPDGFLRDAIVVNGVVPSPLIRAKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATVINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWVRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTPSVIPLIETNLHPLARMPVPGTRTPGGVDKALKLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQELLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNLGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEADQ - 1.10.3.2 - p2 - 0 + + + + + Sub_Oxygen_s1 + oxygen + s1 + -1 0 0 + True + + + + + + + + + Experiment_Laccase - Helically Coiled Reactor (HCR) and Straight Capillary Reactor (SCR) + Creator(s): +given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.university, id: a0 + + + + + + + + Sub_ABTS_red_s0 + ABTS reduced + s0 + -4 + 1 + 0 False - oxidoreductase activity - r0 None 375.15 K - 56000 + 514.619 kg/kmol - -6497 - 80498-15-3 - CC[C@H](C)[C@@H](C(N1CCC[C@H]1C(=O)O)=O)N=C([C@H](CCC(=N)O)N=C([C@H](CCC(=O)O)N=C([C@H](C)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](C(C)C)N=C([C@H](C)N)O)O)O)O)O)O)O) - C66H109N19O25 + -9626 + 28752-68-3 + CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC + C18H17N4O6S4 647.14 22064000 0.05595 @@ -1604,10 +1624,10 @@ process depending on the context in which it occurs. For example, the observed e False False False - Trametes versicolor - 1.10.3.2 - 4.5-5.0 with ABTS as substrate - 35-55 °C with ABTS as substrate + None + None + None + None K Pa m3/kmol @@ -1616,38 +1636,31 @@ process depending on the context in which it occurs. For example, the observed e mL/mol - - - - - - - Experiment_Laccase - Helically Coiled Reactor (HCR) and Straight Capillary Reactor (SCR) - Creator(s): -given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.university, id: a0 - - - - - - - - Sub_ABTS_red_s0 - ABTS reduced - s0 - -4 - 1 + + + + + Sub_Laccase_p2 + Laccase + Trametes versicolor + MGLQRFSFFVTLALVARSLAAIGPVASFVVANAPVSPDGFLRDAIVVNGVVPSPLIRAKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATVINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWVRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTPSVIPLIETNLHPLARMPVPGTRTPGGVDKALKLAFNFNGTNFFINNASFTPPTVPVLLQILSGAQTAQELLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNLGPWFLHCHIDFHLEAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEADQ + 1.10.3.2 + p2 + 0 + 0 0 False + oxidoreductase activity + r0 None 375.15 K - 514.619 + 56000 kg/kmol - -9626 - 28752-68-3 - CC[N+]1\C(SC2=C1C=CC(=C2)[S]([O-])(=O)=O)=N\N=C4/SC3=C(C=CC(=C3)[S]([O-])(=O)=O)N4CC - C18H17N4O6S4 + -6497 + 80498-15-3 + CC[C@H](C)[C@@H](C(N1CCC[C@H]1C(=O)O)=O)N=C([C@H](CCC(=N)O)N=C([C@H](CCC(=O)O)N=C([C@H](C)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](CC(=O)O)N=C([C@H](C(C)C)N=C([C@H](C)N)O)O)O)O)O)O)O) + C66H109N19O25 647.14 22064000 0.05595 @@ -1667,10 +1680,10 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer False False False - None - None - None - None + Trametes versicolor + 1.10.3.2 + 4.5-5.0 with ABTS as substrate + 35-55 °C with ABTS as substrate K Pa m3/kmol @@ -1679,14 +1692,14 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer mL/mol - - + + - + Sub_ABTS_ox_s2 ABTS oxidized s2 @@ -1738,23 +1751,10 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer - - - - - Sub_Oxygen_s1 - oxygen - s1 - -1 - 0 - 0 - True - - - + Sub_Water_ 2 0 @@ -1762,7 +1762,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer True - + @@ -1786,13 +1786,13 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer 1/s - + - - - - - + + + + + indv_Reactant_1 8.33333333333333e-08 m3/s @@ -1800,16 +1800,16 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer mol/s - + - - + + indv_Mixer None None - + Reactant_1_Laccase @@ -1826,7 +1826,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + Reactant_1_ABTS_red @@ -1843,7 +1843,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + Reactant_1_Water @@ -1859,11 +1859,11 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + - - - + + + indv_Reactant_2 5e-08 m3/s @@ -1871,7 +1871,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer mol/s - + Reactant_2_Oxygen @@ -1888,18 +1888,18 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + - - - - - - - - - - + + + + + + + + + + indv_Mixture 1.3457300708425582e-07 m3/s @@ -1907,10 +1907,10 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer mol/s - + - - + + indv_Reactor None None @@ -1929,19 +1929,19 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer 1 - + - - - - - - - - - - - + + + + + + + + + + + indv_Product_1 1.3450320607595866e-07 m3/s @@ -1949,23 +1949,23 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer mol/s - + - - + + indv_Heat None None - + - + - + ABTS oxidation, HTR_r0 311.15 K @@ -1974,9 +1974,9 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer r0 - + - + @@ -1989,9 +1989,9 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer r1 - + - + @@ -2004,7 +2004,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer r2 - + indv_Mixture_Laccase @@ -2013,7 +2013,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Mixture_ABTS_red @@ -2022,7 +2022,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Mixture_Water @@ -2031,7 +2031,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Mixture_Oxygen @@ -2040,7 +2040,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Mixture_Laccase @@ -2049,7 +2049,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Mixture_ABTS_red @@ -2058,7 +2058,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Mixture_Water @@ -2067,7 +2067,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Mixture_Oxygen @@ -2076,7 +2076,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Product_1_ABTS_ox @@ -2085,7 +2085,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Product_1_Laccase @@ -2094,7 +2094,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Product_1_ABTS_red @@ -2103,7 +2103,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Product_1_Water @@ -2112,7 +2112,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Product_1_Oxygen @@ -2121,7 +2121,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Liquid - + indv_Product_1_ABTS_ox @@ -2130,7 +2130,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Product_1_Laccase @@ -2139,7 +2139,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Product_1_ABTS_red @@ -2148,7 +2148,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Product_1_Water @@ -2157,7 +2157,7 @@ given_name: Katrin , family_name: Rosenthal, mail: krosenthal@constructor.univer Vapor - + indv_Product_1_Oxygen